TkA04G373950 | RubberDandelionOmics

Gene overview

TkA04G373950

Reference: TK1151 Chr: Chr04 Coordinates: 94000152-94001624 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1205 bp · TkA04G373950|TK1151|cDNA

CGATAAGGGACTTAAAAGAAACAACAGCAGTACGCTCCCACTTTTTCAGCATCTTCTCTCACACTCTTCGCTCTTCCCTCCAATAATCCATTTTGTTTCCACCCAAAATATTTCGAACTCCTCTCTCGATTCCCTCCAAACTTCAAAAATCAAACTTCCCCCATATCCAGACCTCCATTAATTCAATCTCTATTTATACCCTGTTTAAAGAATCCCATGTTTCACATCAATACAGTTCCCCAGAATTTGTCGCTGACTCC...

CDS

Download CDS FASTA

660 bp · TkA04G373950|TK1151|CDS

ATGTTTCACATCAATACAGTTCCCCAGAATTTGTCGCTGACTCCCACTCTTAACCACAGTGATCACGATCTAATGGCGCAGCCTCCTCGTTCTTCAGGTGAGATTCATGTCATCGTTGGGCCTATGTTCGCCGGTAAAACCACCGCTCTTCTTCGCCGGATCAAAACCGAAGGCACAAACGGCAGGAATATAGCGATGATAAAATCAAGCAAGGATACACGATACGCAGTTAATTCAGTTGTAACACACGATGGGACGAA...

Protein

Download Protein FASTA

219 aa · TkA04G373950|TK1151|PROTEIN

MFHINTVPQNLSLTPTLNHSDHDLMAQPPRSSGEIHVIVGPMFAGKTTALLRRIKTEGTNGRNIAMIKSSKDTRYAVNSVVTHDGTKYPCCALPDLLSFKQKFGEEAYEKLDVIGIDEAQFFDDLYEFCSKAADNDGKTIIVAGLDGDYLRRNFGPVLDIVPLADTITKLTARCEVCGKKAHFTFRKTKETKTELIGGADMYMPVCRQHYVNGQVVIKH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G373950`
TK1151 ID	TkA04G373950
OH-1004 ID	LXL04_038006
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G373950

Location Chr04:94000152-94001624 (-)

Description Similar to TK1A: Thymidine kinase a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07800`	Part of the salvage pathway for purine and pyrimidine deoxyribonucleotide synthesis.	Two thymidine kinases and one multisubstrate deoxyribonucleoside kinase salvage DNA precursors in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1742-4658.2012.08747.x Arabidopsis thaliana thymidine kinase 1a is ubiquitously expressed during development and contributes to confer tolerance to genotoxic stress.2015 · DOI: 10.1007/s11103-014-0277-7
`At5g23070`	Part of the salvage pathway for purine and pyrimidine deoxyribonucleotide synthesis.	Two thymidine kinases and one multisubstrate deoxyribonucleoside kinase salvage DNA precursors in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1742-4658.2012.08747.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0113100`	Thymidine kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038006 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006302 double-strand break repair Biological Process

GO:0006950 response to stress Biological Process

GO:0009409 response to cold Biological Process

GO:0010225 response to UV-C Biological Process

GO:0046104 thymidine metabolic process Biological Process

GO:0046105 thymidine biosynthetic process Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0090351 seedling development Biological Process

GO:1904860 DNA synthesis involved in mitotic DNA replication Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G07800

ath:AT5G23070

gga:395719

mmu:21877

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · TkA04G373950 · TK1151

Nucleus0.541

Rank 2 · TkA04G373950 · TK1151

Mitochondrion0.084

Rank 3 · TkA04G373950 · TK1151

Cell membrane0.033

Rank 4 · TkA04G373950 · TK1151

Endoplasmic reticulum0.025

Rank 5 · TkA04G373950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13604AAA_3018-142 aa

PF25199nSTAND_NTPase526-70 aa

PF00265TK33-210 aa

PF13401AAA_2233-144 aa

PF13173AAA_1434-144 aa

PF02839CBM_5_1272-90 aa

PF25199nSTAND_NTPase5108-142 aa

PF26647zf_Tbcl_3201-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G373950	`PF13604`	AAA_30	18	142	0.16	12.5
TkA04G373950	`PF25199`	nSTAND_NTPase5	26	70	0.039	14.5
TkA04G373950	`PF00265`	TK	33	210	7.9e-56	189.4
TkA04G373950	`PF13401`	AAA_22	33	144	0.074	14.1
TkA04G373950	`PF13173`	AAA_14	34	144	0.0001	23.0
TkA04G373950	`PF02839`	CBM_5_12	72	90	0.18	12.6
TkA04G373950	`PF25199`	nSTAND_NTPase5	108	142	0.039	14.5
TkA04G373950	`PF26647`	zf_Tbcl_3	201	210	0.62	10.4
TkA04G373950	`PF02839`	CBM_5_12	209	216	0.18	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S750`	Arabidopsis thaliana	sp\|Q9S750\|KITHA_ARATH Thymidine kinase a	72.500%	Swiss-Prot	High
`F4KBF5`	Arabidopsis thaliana	sp\|F4KBF5\|KITHB_ARATH Thymidine kinase b	70.400%	Swiss-Prot	High
`O81263`	Oryza sativa subsp. japonica	sp\|O81263\|KITH_ORYSJ Thymidine kinase	72.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card