TkA04G373940 | RubberDandelionOmics

Gene overview

TkA04G373940

Reference: TK1151 Chr: Chr04 Coordinates: 93996685-94000024 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1884 bp · TkA04G373940|TK1151|cDNA

ATGCTTTCAAGTCCTTTGTCTTCTCCAAATGTCACCGCCCTTCTCAAAATCAAGATCATTTCATGGAGTCAAGAAACAGGCTTACCCGCTTCGGTTTGTGTCCATGTTTCTGACAGAATCTTCAATCTTCATAAGTATCCTTTATGCTCCAAAAGCGGATTCTTTAACAGAAAACTAACGGAATCAAACATCGTTAACTTACCCGACAATTTCCCTGGTGGGCCCGAGACATTTGAAATGATTTCACTTTTTATCTACGG...

CDS

Download CDS FASTA

1884 bp · TkA04G373940|TK1151|CDS

ATGCTTTCAAGTCCTTTGTCTTCTCCAAATGTCACCGCCCTTCTCAAAATCAAGATCATTTCATGGAGTCAAGAAACAGGCTTACCCGCTTCGGTTTGTGTCCATGTTTCTGACAGAATCTTCAATCTTCATAAGTATCCTTTATGCTCCAAAAGCGGATTCTTTAACAGAAAACTAACGGAATCAAACATCGTTAACTTACCCGACAATTTCCCTGGTGGGCCCGAGACATTTGAAATGATTTCACTTTTTATCTACGG...

Protein

Download Protein FASTA

627 aa · TkA04G373940|TK1151|PROTEIN

MLSSPLSSPNVTALLKIKIISWSQETGLPASVCVHVSDRIFNLHKYPLCSKSGFFNRKLTESNIVNLPDNFPGGPETFEMISLFIYGSSTLVDPFNVAALRCASEYLEMTEEYTSGNLCERFDIYLNQVVLQSWEDTLIVLQQCQRQNLVPWAEELLIVSRCIESLAFMACMEILDPERRRDQPVVTLEAISFQKWSSEMVQEILTQDVWIKDLIALPFGYFKRVISSLRRQGMKEKYVTPIVLFHANLVLENGRKEDMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G373940`
TK1151 ID	TkA04G373940
OH-1004 ID	LXL04_038005
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 98.464 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G373940

Location Chr04:93996685-94000024 (+)

Description Similar to At5g48130: BTB/POZ domain-containing protein At5g48130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48130`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g67385`	Acts as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (Probable).	No verified direct reference in this release
`At5g67440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 NPY genes play an essential role in root gravitropic responses in Arabidopsis.2011 · DOI: 10.1093/mp/ssq052
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038005 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009904 chloroplast accumulation movement Biological Process

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT5G13600

ath:AT5G48130

ath:AT5G67385

ath:AT5G67440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.440

Rank 1 · TkA04G373940 · TK1151

Cytoplasm0.416

Rank 2 · TkA04G373940 · TK1151

Cell membrane0.149

Rank 3 · TkA04G373940 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA04G373940 · TK1151

Golgi apparatus0.048

Rank 5 · TkA04G373940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651BTB32-110 aa

PF03000NPH3208-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G373940	`PF00651`	BTB	32	110	0.0022	18.9
TkA04G373940	`PF03000`	NPH3	208	446	4.1e-49	168.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUB9`	Arabidopsis thaliana	sp\|Q9LUB9\|Y5813_ARATH BTB/POZ domain-containing protein At5g48130	51.400%	Swiss-Prot	High
`Q66GP0`	Arabidopsis thaliana	sp\|Q66GP0\|SR1P1_ARATH BTB/POZ domain-containing protein SR1IP1	30.300%	Swiss-Prot	Medium
`Q9FN09`	Arabidopsis thaliana	sp\|Q9FN09\|NPY3_ARATH Phototropic-responsive NPH3 family protein NPY3	31.600%	Swiss-Prot	Medium
`Q9S9Q9`	Arabidopsis thaliana	sp\|Q9S9Q9\|Y1044_ARATH BTB/POZ domain-containing protein At1g30440	31.300%	Swiss-Prot	Medium
`Q9FNB3`	Arabidopsis thaliana	sp\|Q9FNB3\|Y5360_ARATH Putative BTB/POZ domain-containing protein At5g13600	31.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card