RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G373630
Reference: TK1151 Chr: Chr04 Coordinates: 93908609-93913260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2742 bp · TkA04G373630|TK1151|cDNA

GTCGCCTCTATAATCTCCTACATTTTAGAGTTTAACCAGTAAAATAGTCGCACTAGCAGATTCAACACTGTAACTTCCTCCTGATCCCCCTCCCTCTCGAATTGACTTTCATATATCACATTATTCACACAATTTACAGGTTTCAATTAACCCTCTCTTCCAACCAAAATCCTTTATTTAACGAGCGAAAATCCCATTCGAAGATTTGGTTTAAACCCACCTCCCAATTGAAGTTTCTGTTCTTATTGGATTTGAATCCA...

CDS

Download CDS FASTA

1623 bp · TkA04G373630|TK1151|CDS

ATGGACTTTTCAGAATCTACGAAAATCGTATACGATAGGATCCAAAAAATCGATCCTGAAAATGTCTCCAAGATTGTTGGATACCTTCTTCTACAAGATCATGGTGAAAGAGAAATGATAAGATTAGCATATTGCCCCGATAACTTAATCCACTCTTTAATCAAAAAAGCAAAATCCCACCTCAATTTACTACCCAATTCCAAAATCCCCGAAATGCCCCTACACTTCACACCATTCACACCTTCAACCCCTACCACCCG...

Protein

Download Protein FASTA

540 aa · TkA04G373630|TK1151|PROTEIN

MDFSESTKIVYDRIQKIDPENVSKIVGYLLLQDHGEREMIRLAYCPDNLIHSLIKKAKSHLNLLPNSKIPEMPLHFTPFTPSTPTTRHSPLTIQIPSQPVDYLPMVNYPASFPEDYNLLHNHNRLRFLDDPFDSVNSVNSPDFSLGHIRANRRSPSLPEFPFKVCHYFIKGFCRHGNNCRYLHPTSELTFNYFEDETVFSPGSLEKLELELTELLKARKGFPLSIASLPMMYYEKFGKSLQAEGYLTESQRHGKAGYSLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G373630
TK1151 IDTkA04G373630
OH-1004 IDLXL04_037999
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G373630
LocationChr04:93908609-93913260 (+)
DescriptionSimilar to At2g05160: Zinc finger CCCH domain-containing protein 18
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g05160 Possesses ribonuclease activity in vitro. No verified direct reference in this release
At3g51950 Possesses RNA-binding and ribonuclease activities in vitro. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0126700 Zinc finger CCCH domain-containing protein 54. No verified direct reference in this release
Os03g0328900 Zinc finger CCCH domain-containing protein 22. No verified direct reference in this release
Os07g0583300 Putative zinc finger CCCH domain-containing protein 51. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037999 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0003677 DNA binding Molecular Function
GO:0003723 RNA binding Molecular Function
GO:0003729 mRNA binding Molecular Function
GO:0004518 nuclease activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference
ath:AT2G05160
ath:AT3G51950
dosa:Os08g0126700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566
Rank 1 · TkA04G373630 · TK1151
Nucleus0.465
Rank 2 · TkA04G373630 · TK1151
Cell membrane0.055
Rank 3 · TkA04G373630 · TK1151
Mitochondrion0.047
Rank 4 · TkA04G373630 · TK1151
Endoplasmic reticulum0.035
Rank 5 · TkA04G373630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23182PABC_AtC3H461-66 aa
PF00658MLLE10-49 aa
PF16131Torus163-184 aa
PF18044zf-CCCH_4163-184 aa
PF22628zf-CCCH_10164-189 aa
PF00642zf-CCCH164-184 aa
PF18345zf_CCCH_4165-183 aa
PF14608zf-CCCH_2165-184 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G373630PF23182PABC_AtC3H461661.2e-34119.1
TkA04G373630PF00658MLLE10490.1113.2
TkA04G373630PF16131Torus1631844.5e-0524.7
TkA04G373630PF18044zf-CCCH_41631849.4e-0522.8
TkA04G373630PF22628zf-CCCH_101641890.000320.9
TkA04G373630PF00642zf-CCCH1641840.001119.5
TkA04G373630PF18345zf_CCCH_41651833.8e-0524.3
TkA04G373630PF14608zf-CCCH_21651840.09114.0
TkA04G373630PF25585zf-CCCH_DUS3L1651830.1812.5
TkA04G373630PF12872OST-HTH2032790.001119.5
TkA04G373630PF23085RRM_PARP14_33253880.08113.7
TkA04G373630PF00076RRM_13263752.1e-0525.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SJ41Arabidopsis thalianasp|Q9SJ41|C3H18_ARATH Zinc finger CCCH domain-containing protein 1846.900%Swiss-ProtMedium
Q9SV09Arabidopsis thalianasp|Q9SV09|C3H46_ARATH Zinc finger CCCH domain-containing protein 4637.200%Swiss-ProtMedium
Q6ZK57Oryza sativa subsp. japonicasp|Q6ZK57|C3H54_ORYSJ Zinc finger CCCH domain-containing protein 5436.000%Swiss-ProtMedium
Q10M00Oryza sativa subsp. japonicasp|Q10M00|C3H22_ORYSJ Zinc finger CCCH domain-containing protein 2229.600%Swiss-ProtLow
Q84ZT0Oryza sativa subsp. japonicasp|Q84ZT0|C3H51_ORYSJ Putative zinc finger CCCH domain-containing protein 5143.900%Swiss-ProtMedium

JBrowse

View in Genome Browser