TkA04G372580 | RubberDandelionOmics

Gene overview

TkA04G372580

Reference: TK1151 Chr: Chr04 Coordinates: 93610696-93613751 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2430 bp · TkA04G372580|TK1151|cDNA

TTTTACTCTTCTTTATTATTTAAATTAATTAATTAATAACTCCTTGCTTAAAACTTCGACAACCTATTATCACATTATTATATATAATTTGTTTTATAACACTTTAAACTTACATATATTTTGTGGTCGGCGATTTGACGAAATCTTCATTTCTTCCTCCACCGTTATTAGATTTTATTTACAAGAAAGTTAGCGTCTTTCATTTTCATTTATCCGAGATCTGAAGCAAACTGGGCACGAATCCACCGACTGATTTGAGA...

CDS

Download CDS FASTA

1905 bp · TkA04G372580|TK1151|CDS

ATGGGATCAAACATAGAAGAAGCTCTAATCGCAAAAGAAAACGCCGAAAAGCTATTCACATTACAAGACTTCACAGGCGCAAAACACTACGCCCTAAAAGCTCAAGCAATATGCCCACAACTCGAGGGCATTTCCCAAATGGTCGCGACTTTTGAAATCTACGCAGCAACCCTCACGAAAATCAACAATGAAATCGACTTATACTCCATCCTCGGACTAAACCCATCATCCGACAAATCATCCCTCAAGAAACAATACAA...

Protein

Download Protein FASTA

634 aa · TkA04G372580|TK1151|PROTEIN

MGSNIEEALIAKENAEKLFTLQDFTGAKHYALKAQAICPQLEGISQMVATFEIYAATLTKINNEIDLYSILGLNPSSDKSSLKKQYKKMAVLLHPDKNKTMGADEAFKLVSEAWSVLSDNTKRHLYDVRRNKHLTTSANLRLDTFWTVCTSCRVQYEYLRKYVNKRLSCKNCRGVFVAVETGSAPVTYCPWSYTTTTENGYGNHSNHYTDYNHNHNHNHNHNHNPATYIQNSSVSFTGDGTSGYHSEYTKNLSFQWNMPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G372580`
TK1151 ID	TkA04G372580
OH-1004 ID	LXL04_037993
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G372580`
Location	Chr04:93610696-93613751 (+)
Description	Similar to dnaJ: Chaperone protein DnaJ (Staphylococcus epidermidis (strain ATCC 12228)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037993` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0006986 response to unfolded protein Biological Process GO:0009408 response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0031072 heat shock protein binding Molecular Function
KEGG gene cross-reference	mma:MM_2504 sep:SE_1266 ser:SERP1147 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA04G372580 · TK1151

Cytoplasm0.090

Rank 2 · TkA04G372580 · TK1151

Cell membrane0.030

Rank 3 · TkA04G372580 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA04G372580 · TK1151

Plastid0.013

Rank 5 · TkA04G372580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ66-127 aa

PF31240PylS_N127-165 aa

PF17283Zn_ribbon_SprT144-177 aa

PF23551Zn_ribbon_20145-179 aa

PF22191IBR_1149-175 aa

PF04592SelP_N167-239 aa

PF11926DUF3444373-580 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G372580	`PF00226`	DnaJ	66	127	1.3e-20	73.9
TkA04G372580	`PF31240`	PylS_N	127	165	0.046	14.7
TkA04G372580	`PF17283`	Zn_ribbon_SprT	144	177	0.018	15.8
TkA04G372580	`PF23551`	Zn_ribbon_20	145	179	2.3e-13	50.6
TkA04G372580	`PF22191`	IBR_1	149	175	0.21	12.2
TkA04G372580	`PF04592`	SelP_N	167	239	0.19	11.8
TkA04G372580	`PF11926`	DUF3444	373	580	6.7e-76	255.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card