TkA04G360070 | RubberDandelionOmics

Gene overview

TkA04G360070

Reference: TK1151 Chr: Chr04 Coordinates: 90698110-90699732 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1322 bp · TkA04G360070|TK1151|cDNA

ATGGTATGACCCTTTATGTAATTTTATAATATAAAACCTTGCACAGTAGATTTGAAAATACCTTCTTCAACGTAAATATTAAATTACAGTTATGAAATATGTACACAAAAACATAATTAGTATATCATTCAAAACAAGCTGAGTTACATTAATAAGGGGATATTTTCTAATGTTCTGAATGTTCTACTAAAATGTTATCTGTAAATTATTAATACTTCAACTGTTTAATGTTGAGAGTGTTTATTACAATGCCTAAACAA...

CDS

Download CDS FASTA

348 bp · TkA04G360070|TK1151|CDS

ATGGCTAAGCAAAAGATTGTAGTGAAGGTCACAATGAACAACGAAAAGAAGATTCGTAAGGCTTTGAAGATCGCCGTCAGTCTCTCCGGTGTGGAATCGGCGTCATTTGTTGGTTCAGATAAAAGCCAGATCGCTGTCACCGGGGAAGATGTTGACTCAGTGGAACTGGTGACGTTGCTAAGGAAAGGTGTAGGATACACAGAGCTAGTGAGTGTTGGTCCGGTGGAGGAGAAGAAACCTGCCGCCGCCAAAGAAACGAA...

Protein

Download Protein FASTA

115 aa · TkA04G360070|TK1151|PROTEIN

MAKQKIVVKVTMNNEKKIRKALKIAVSLSGVESASFVGSDKSQIAVTGEDVDSVELVTLLRKGVGYTELVSVGPVEEKKPAAAKETKPTAEIVYAGNPYQYYYGSYGTPFYAYEY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G360070`
TK1151 ID	TkA04G360070
OH-1004 ID	LXL04_037921
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.800
Protein coverage (%)	TK1151 95.652 / OH-1004 34.385 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G360070

Location Chr04:90698110-90699732 (+)

Description Similar to HIPP16: Heavy metal-associated isoprenylated plant protein 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48290`	Probable heavy-metal-binding protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: F2VYU4`	Disease resistance (R) protein that specifically recognizes the AVR-Pik effector avirulence protein from M.oryzae.	No verified direct reference in this release
`UniProt: B5UBC1`	Disease resistance (R) protein that specifically recognizes the AVR-Pik effector avirulence protein from M.oryzae.	No verified direct reference in this release
`UniProt: P0DO09`	Disease resistance (R) protein that specifically recognizes the AVR-Pik effector avirulence protein from M.oryzae.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037921 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G07600

ath:AT5G48290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · TkA04G360070 · TK1151

Nucleus0.332

Rank 2 · TkA04G360070 · TK1151

Cell membrane0.202

Rank 3 · TkA04G360070 · TK1151

Mitochondrion0.050

Rank 4 · TkA04G360070 · TK1151

Extracellular0.048

Rank 5 · TkA04G360070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23232AAA_lid_138-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G360070	`PF23232`	AAA_lid_13	8	54	0.12	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PNZ7`	Arabidopsis thaliana	sp\|Q5PNZ7\|HIP46_ARATH Heavy metal-associated isoprenylated plant protein 46	45.500%	Swiss-Prot	Medium
`F2VYU4`	Oryza sativa subsp. japonica	sp\|F2VYU4\|PIK1_ORYSJ Disease resistance protein Pik-1	40.500%	Swiss-Prot	Medium
`B5UBC1`	Oryza sativa subsp. japonica	sp\|B5UBC1\|PIKM1_ORYSJ Disease resistance protein Pikm1-TS	39.200%	Swiss-Prot	Medium
`P0DO09`	Oryza sativa subsp. japonica	sp\|P0DO09\|PIKS1_ORYSJ Disease resistance protein Piks-1	36.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card