TkA04G358440 | RubberDandelionOmics

Gene overview

TkA04G358440

Reference: TK1151 Chr: Chr04 Coordinates: 90316158-90318513 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1312 bp · TkA04G358440|TK1151|cDNA

GTGAAAGCAAAATCCCACCGACTTTTTGCGAAGTGCAAACCCTCCCGTAACTCTTGGCTTTTGCATCGCTTAATGCTACGAGTCATACCCATTTCGAAGCGATAGTCGGCCTCGGAAATGGCGGATCAGAGTAGCAATCCTCCAGTCAGGGAAGGAATGCTGACCTACTGCTACCTCCTTCTCTACATAGCCCTCTCCAGCGGCCAGATCTTCTTCAACAAGTGGGTGTTGTCATCAAAGGAGATAAATTTCCCATATCC...

CDS

Download CDS FASTA

1005 bp · TkA04G358440|TK1151|CDS

ATGGCGGATCAGAGTAGCAATCCTCCAGTCAGGGAAGGAATGCTGACCTACTGCTACCTCCTTCTCTACATAGCCCTCTCCAGCGGCCAGATCTTCTTCAACAAGTGGGTGTTGTCATCAAAGGAGATAAATTTCCCATATCCACTTGGCTTGACGCTTCTTCACATGGTGTTTTCCTCTGTACTTTGCTTTATACTCACCAAATTCTTCAAGATTTTAAAAGTTGAAGATGGAATGACTCTCGATATATACACTTCATC...

Protein

Download Protein FASTA

334 aa · TkA04G358440|TK1151|PROTEIN

MADQSSNPPVREGMLTYCYLLLYIALSSGQIFFNKWVLSSKEINFPYPLGLTLLHMVFSSVLCFILTKFFKILKVEDGMTLDIYTSSVIPIGAMFAMTLWLGNTAYLYISVAFAQMLKAVMPVAVFILGVAAGLEVMSTRMLLIMCLISFGVLVASYGEININWIGVVYQMGGVVGEALRLIFMEILVKRKGLKLNPISMMYYVSPCSALCLLVPWVFLEKPKMMDDAQGATWSFHPMVLTLNSLCTFGLNLSVFLVIQH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G358440`
TK1151 ID	TkA04G358440
OH-1004 ID	LXL04_037888
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G358440

Location Chr04:90316158-90318513 (+)

Description Similar to At3g14410: Probable sugar phosphate/phosphate translocator At3g14410

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14410`	Probable sugar phosphate/phosphate translocator At3g14410.	No verified direct reference in this release
`At1g53660`	Probable sugar phosphate/phosphate translocator At1g53660.	No verified direct reference in this release
`At1g48230`	Probable sugar phosphate/phosphate translocator At1g48230.	No verified direct reference in this release
`At3g17430`	Probable sugar phosphate/phosphate translocator At3g17430.	No verified direct reference in this release
`At5g11230`	Probable sugar phosphate/phosphate translocator At5g11230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037888 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G48230

ath:AT1G53660

ath:AT3G14410

ath:AT3G17430

ath:AT5G11230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.698

Rank 1 · TkA04G358440 · TK1151

Endoplasmic reticulum0.241

Rank 2 · TkA04G358440 · TK1151

Cytoplasm0.109

Rank 3 · TkA04G358440 · TK1151

Cell membrane0.044

Rank 4 · TkA04G358440 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA04G358440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA18-156 aa

PF03151TPT19-309 aa

PF00892EamA166-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G358440	`PF00892`	EamA	18	156	8.8e-06	26.8
TkA04G358440	`PF03151`	TPT	19	309	8.4e-27	95.0
TkA04G358440	`PF00892`	EamA	166	306	8.8e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94EI9`	Arabidopsis thaliana	sp\|Q94EI9\|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410	82.200%	Swiss-Prot	High
`Q9C8M1`	Arabidopsis thaliana	sp\|Q9C8M1\|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660	74.600%	Swiss-Prot	High
`Q9LNH5`	Arabidopsis thaliana	sp\|Q9LNH5\|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230	51.000%	Swiss-Prot	High
`Q9LRP2`	Arabidopsis thaliana	sp\|Q9LRP2\|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430	50.300%	Swiss-Prot	High
`Q9LFN3`	Arabidopsis thaliana	sp\|Q9LFN3\|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230	44.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card