TkA04G353930 | RubberDandelionOmics

Gene overview

TkA04G353930

Reference: TK1151 Chr: Chr04 Coordinates: 89268037-89276120 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2083 bp · TkA04G353930|TK1151|cDNA

TACCCTCGCATCCCTAGTTTAGTTTTGGTATTTTGTATATTTATTTAATTTGTATAAAACTATGCTAAAAATGTTTATACATCTCATTTTACAAACCGCTTACTGTTGACCTTTCTTGACTCATTCACAAGTATACACAGAGGAGTGCGATGAGTGGCAGCATGACATCGATCTCGCCGTCAACGCCATGGCCTGCACGATCGCAGACCAACAACACCCACCGGCAATCCATTGTAAACCTGAAACCCGCCACCAATTTT...

CDS

Download CDS FASTA

1230 bp · TkA04G353930|TK1151|CDS

ATGAGTGGCAGCATGACATCGATCTCGCCGTCAACGCCATGGCCTGCACGATCGCAGACCAACAACACCCACCGGCAATCCATTGTAAACCTGAAACCCGCCACCAATTTTTCAATCCCCAATTCCATCATCCGATCAAGAAGAAAAAACTCAAAATCATTCCCATCTTTCATCGTCAACTCTGCTGCCGAATCCCCAAATCAACCCACCGGAAAATCCAAATCACCGCCATTGGTGGTCGTCGGATCAGCCAATGCCGA...

Protein

Download Protein FASTA

409 aa · TkA04G353930|TK1151|PROTEIN

MSGSMTSISPSTPWPARSQTNNTHRQSIVNLKPATNFSIPNSIIRSRRKNSKSFPSFIVNSAAESPNQPTGKSKSPPLVVVGSANADIYVEIDRLPKEGETISAKTGQTLAGGKGANQAVCGGMLSYPTYFVGQVGKDAHGKLIMEALEGGGVHIDHLNEVSAEPTGHAVVMLQSDGQNSIIIVGGANMCGWPDNLSESDLKTVKNAGIVLLQREIPDSINIQVAKAAKSAGVPVILDAGGMDSPIPVELLKHVDILSPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G353930`
TK1151 ID	TkA04G353930
OH-1004 ID	LXL04_037817
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 93.399 / OH-1004 94.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G353930

Location Chr04:89268037-89276120 (+)

Description Similar to RBSK: Ribokinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17160`	Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium.	Identification of the Plant Ribokinase and Discovery of a Role for Arabidopsis Ribokinase in Nucleoside Metabolism.2016 · DOI: 10.1074/jbc.m116.754689

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037817 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0009116 nucleoside metabolic process Biological Process

GO:0019303 D-ribose catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0042646 plastid nucleoid Cellular Component

GO:0004747 ribokinase activity Molecular Function

GO:0004751 ribose-5-phosphate isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17160

bsu:BSU35920

hin:HI_0505

sac:SACOL0253

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA04G353930 · TK1151

Mitochondrion0.051

Rank 2 · TkA04G353930 · TK1151

Cytoplasm0.024

Rank 3 · TkA04G353930 · TK1151

Nucleus0.016

Rank 4 · TkA04G353930 · TK1151

Peroxisome0.014

Rank 5 · TkA04G353930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00294PfkB78-353 aa

PF01256Carb_kinase228-334 aa

PF08543Phos_pyr_kin249-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G353930	`PF00294`	PfkB	78	353	2.4e-54	185.4
TkA04G353930	`PF01256`	Carb_kinase	228	334	0.0013	19.0
TkA04G353930	`PF08543`	Phos_pyr_kin	249	353	3.3e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A1A6H3`	Arabidopsis thaliana	sp\|A1A6H3\|RBSK_ARATH Ribokinase	77.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card