TkA04G353190 | RubberDandelionOmics

Gene overview

TkA04G353190

Reference: TK1151 Chr: Chr04 Coordinates: 89128075-89129545 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · TkA04G353190|TK1151|cDNA

ATGTCAGAGGAACAGCTTCAACAGCTCGCTATTGACTTCGGCCAGCAAAGTTATAGAGGCAAACAATTGCATCATATTCTGTACAAGCGAAGGGTTAAGGATATTCAAGAATTCAGTCAAGTGCCTCTAGCATTCAGAACCGAACTCCAAGAAGCTGGTTGGTTGGTCGGGAGGTCATCTGTGCATAGTTCTGTAAAGGCAGCTGATGGCACTATCAAGTTACTGATAAAATTGGAAGATAATCGACTGGTGGAAACTGT...

CDS

Download CDS FASTA

825 bp · TkA04G353190|TK1151|CDS

ATGTCAGAGGAACAGCTTCAACAGCTCGCTATTGACTTCGGCCAGCAAAGTTATAGAGGCAAACAATTGCATCATATTCTGTACAAGCGAAGGGTTAAGGATATTCAAGAATTCAGTCAAGTGCCTCTAGCATTCAGAACCGAACTCCAAGAAGCTGGTTGGTTGGTCGGGAGGTCATCTGTGCATAGTTCTGTAAAGGCAGCTGATGGCACTATCAAGTTACTGATAAAATTGGAAGATAATCGACTGGTGGAAACTGT...

Protein

Download Protein FASTA

274 aa · TkA04G353190|TK1151|PROTEIN

MSEEQLQQLAIDFGQQSYRGKQLHHILYKRRVKDIQEFSQVPLAFRTELQEAGWLVGRSSVHSSVKAADGTIKLLIKLEDNRLVETVGIPVADDKGFVLLTCCVSSQVGCPLRCSFCATGNGGFSRNLKGHEIVEQVLAIEEVFNNRVTNVVFMGMGELMLNLKEVLAAHRCLNKDVQIGQRMMTISTVGVPNTIKKLASHKLQSTLALSLHAPNQKLREKIVPSAKAYPLEAIMKDCPKQTLKISALDIEELADQLGLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G353190`
TK1151 ID	TkA04G353190
OH-1004 ID	LXL04_005851
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G353190`
Location	Chr04:89128075-89129545 (-)
Description	Similar to rlmN: Probable dual-specificity RNA methyltransferase RlmN (Acaryochloris marina (strain MBIC 11017)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005851` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0030488 tRNA methylation Biological Process GO:0070475 rRNA base methylation Biological Process GO:0005737 cytoplasm Cellular Component GO:0000049 tRNA binding Molecular Function GO:0002935 tRNA (adenine(37)-C2)-methyltransferase activity Molecular Function GO:0019843 rRNA binding Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function GO:0070040 rRNA (adenine(2503)-C2-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	amr:AM1_3982 cya:CYA_2570 mar:MAE_12550 npu:Npun_F3954 tel:tll2425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.439

Rank 1 · TkA04G353190 · TK1151

Cytoplasm0.385

Rank 2 · TkA04G353190 · TK1151

Nucleus0.251

Rank 3 · TkA04G353190 · TK1151

Plastid0.057

Rank 4 · TkA04G353190 · TK1151

Peroxisome0.052

Rank 5 · TkA04G353190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21016RlmN_N1-51 aa

PF19238Radical_SAM_294-117 aa

PF04055Radical_SAM105-225 aa

PF13353Fer4_12107-178 aa

PF21016RlmN_N153-169 aa

PF19238Radical_SAM_2194-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G353190	`PF21016`	RlmN_N	1	51	0.00012	22.5
TkA04G353190	`PF19238`	Radical_SAM_2	94	117	0.67	10.4
TkA04G353190	`PF04055`	Radical_SAM	105	225	9.9e-13	49.3
TkA04G353190	`PF13353`	Fer4_12	107	178	0.043	14.9
TkA04G353190	`PF21016`	RlmN_N	153	169	0.00012	22.5
TkA04G353190	`PF19238`	Radical_SAM_2	194	245	0.67	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card