TkA04G351230 | RubberDandelionOmics

Gene overview

TkA04G351230

Reference: TK1151 Chr: Chr04 Coordinates: 88630611-88633724 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1099 bp · TkA04G351230|TK1151|cDNA

CGAAAATTCGCCCAAAAAATCCTTAGAGGTTTATGCCGCCGATAATTGAGATTAAAAAAAAAAAAAAAAAAAACACAATTATTCAATTAAACCACGCAATCCTAAACGCCGCCTCGTTTGAAAACTAATGAAATTCGATAAAAATGGAGCCTTCCTGATGCTTGTTTTACTGGAGAAATGTCGGGACCGGAATGCTTTGCGAATCCACCGGAGCAGAGCAGTAGTTCTGGAAAAGGAAGCGTCGAAGTAATCGGAGGCCT...

CDS

Download CDS FASTA

723 bp · TkA04G351230|TK1151|CDS

ATGTCGGGACCGGAATGCTTTGCGAATCCACCGGAGCAGAGCAGTAGTTCTGGAAAAGGAAGCGTCGAAGTAATCGGAGGCCTGAAAGCGTATATCACTGGGAATCGCTCTTCCCCTCGAGCCATCCTTCTTGCTTCCGATGCTTTCGGCTATGAAGGAGTTATGCTGAGAAAACTAGCTGACAAAATGGGTGCTCTTGGATACCTGATTGTGGTTCCTGATTTCTTCTTTGGGGATTGTGTTTACACCACAATGGCTCC...

Protein

Download Protein FASTA

240 aa · TkA04G351230|TK1151|PROTEIN

MSGPECFANPPEQSSSSGKGSVEVIGGLKAYITGNRSSPRAILLASDAFGYEGVMLRKLADKMGALGYLIVVPDFFFGDCVYTTMAPELRANWLPNHPPEKGCEHALKIIAEIRSRSRVSSVGAVGFCWGGMMVIKLAKYDEDIKAAVILHPGRLTDNDVNDVRVPIAILGGELDQLCPQEEVKRYGEILSAKPQVDSYVKIFPGVGHGWASRYNEDDESALRSAEEAHTDMLNWLSNYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G351230`
TK1151 ID	TkA04G351230
OH-1004 ID	LXL04_003142
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.400
Protein coverage (%)	TK1151 100.000 / OH-1004 82.746 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G351230`
Location	Chr04:88630611-88633724 (+)
Description	Similar to Endo-1,3;1,4-beta-D-glucanase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003142` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005576 extracellular region Cellular Component GO:0005829 cytosol Cellular Component GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference	mmu:69574 xla:495096 xtr:394496 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.803

Rank 1 · TkA04G351230 · TK1151

Nucleus0.314

Rank 2 · TkA04G351230 · TK1151

Endoplasmic reticulum0.060

Rank 3 · TkA04G351230 · TK1151

Cell membrane0.052

Rank 4 · TkA04G351230 · TK1151

Peroxisome0.049

Rank 5 · TkA04G351230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01738DLH29-239 aa

PF12146Hydrolase_438-72 aa

PF00561Abhydrolase_1105-152 aa

PF12146Hydrolase_4108-152 aa

PF12740PETase112-182 aa

PF12695Abhydrolase_5119-214 aa

PF00326Peptidase_S9120-148 aa

PF08840BAAT_C120-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G351230	`PF01738`	DLH	29	239	1.4e-31	110.5
TkA04G351230	`PF12146`	Hydrolase_4	38	72	0.0027	17.8
TkA04G351230	`PF00561`	Abhydrolase_1	105	152	7.2e-05	23.3
TkA04G351230	`PF12146`	Hydrolase_4	108	152	0.0027	17.8
TkA04G351230	`PF12740`	PETase	112	182	9.3e-05	22.7
TkA04G351230	`PF12695`	Abhydrolase_5	119	214	0.021	15.3
TkA04G351230	`PF00326`	Peptidase_S9	120	148	0.015	15.5
TkA04G351230	`PF08840`	BAAT_C	120	158	0.32	11.7
TkA04G351230	`PF02230`	Abhydrolase_2	122	210	0.11	13.1
TkA04G351230	`PF20408`	Abhydrolase_11	154	220	0.078	13.4
TkA04G351230	`PF12146`	Hydrolase_4	158	209	0.0027	17.8
TkA04G351230	`PF00561`	Abhydrolase_1	161	208	7.2e-05	23.3
TkA04G351230	`PF00326`	Peptidase_S9	163	219	0.015	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card