TkA04G350770 | RubberDandelionOmics

Gene overview

TkA04G350770

Reference: TK1151 Chr: Chr04 Coordinates: 88527854-88535118 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1481 bp · TkA04G350770|TK1151|cDNA

ATGACACCACATTCTCAAGCCTTGGAAGACGCTATTTCGATATATCAGTTCAAGTCGGGTGTTTTGGTACGGAAAAACTTTAACATCGCGAAAGAAGCTAATGGTGTTGGGAGGGGGATGTCTATAGATTTTAATGAGGTTATGGTAAACGGTAGTACGTTAGAGATCCATTTGTATTGGGCTGGAAAAGGGACGACTTCTGTTCCTAATCGAGGTGTATATGGACCCCTTATATCAGCTATCGCAATAACGCCGAGGCT...

CDS

Download CDS FASTA

888 bp · TkA04G350770|TK1151|CDS

ATGACACCACATTCTCAAGCCTTGGAAGACGCTATTTCGATATATCAGTTCAAGTCGGGTGTTTTGGTACGGAAAAACTTTAACATCGCGAAAGAAGCTAATGGTGTTGGGAGGGGGATGTCTATAGATTTTAATGAGGTTATGGTAAACGGTAGTACGTTAGAGATCCATTTGTATTGGGCTGGAAAAGGGACGACTTCTGTTCCTAATCGAGGTGTATATGGACCCCTTATATCAGCTATCGCAATAACGCCGAGGCT...

Protein

Download Protein FASTA

295 aa · TkA04G350770|TK1151|PROTEIN

MTPHSQALEDAISIYQFKSGVLVRKNFNIAKEANGVGRGMSIDFNEVMVNGSTLEIHLYWAGKGTTSVPNRGVYGPLISAIAITPRLVLAVLWWFGYIGGDKEDKELRALELQTGYFSLRQLKSATHNFDSGKLNDGSEIAVKQLSARSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARAHFGKEDQRLNLDLPTRKRICIGIAKGLAYLHEESRLKIVHRDIKATHVLLDKDLNAKISDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G350770`
TK1151 ID	TkA04G350770
OH-1004 ID	LXL04_037782
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.900
Protein coverage (%)	TK1151 89.492 / OH-1004 29.057 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G350770

Location Chr04:88527854-88535118 (-)

Description Similar to At1g53430: Probable LRR receptor-like serine/threonine-protein kinase At1g53430

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53440`	Probable LRR receptor-like serine/threonine-protein kinase At1g53440.	No verified direct reference in this release
`At1g53430`	Probable LRR receptor-like serine/threonine-protein kinase At1g53430.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release
`At1g53420`	Probable LRR receptor-like serine/threonine-protein kinase At1g53420.	No verified direct reference in this release
`At1g29720`	Probable LRR receptor-like serine/threonine-protein kinase At1g29720.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037782 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07650

ath:AT1G53420

ath:AT1G53430

ath:AT1G53440

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.664

Rank 1 · TkA04G350770 · TK1151

Endoplasmic reticulum0.151

Rank 2 · TkA04G350770 · TK1151

Cytoplasm0.120

Rank 3 · TkA04G350770 · TK1151

Nucleus0.084

Rank 4 · TkA04G350770 · TK1151

Lysosome / Vacuole0.054

Rank 5 · TkA04G350770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11721Malectin20-81 aa

PF07714PK_Tyr_Ser-Thr134-272 aa

PF00069Pkinase135-283 aa

PF12330Haspin_kinase231-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G350770	`PF11721`	Malectin	20	81	1.6e-09	38.7
TkA04G350770	`PF07714`	PK_Tyr_Ser-Thr	134	272	4.5e-29	102.3
TkA04G350770	`PF00069`	Pkinase	135	283	8.6e-28	98.2
TkA04G350770	`PF12330`	Haspin_kinase	231	277	0.0025	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGG9`	Arabidopsis thaliana	sp\|C0LGG9\|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440	63.900%	Swiss-Prot	High
`C0LGG8`	Arabidopsis thaliana	sp\|C0LGG8\|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430	63.500%	Swiss-Prot	High
`C0LGE0`	Arabidopsis thaliana	sp\|C0LGE0\|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650	59.200%	Swiss-Prot	High
`C0LGG7`	Arabidopsis thaliana	sp\|C0LGG7\|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420	66.500%	Swiss-Prot	Medium
`Q9ASQ6`	Arabidopsis thaliana	sp\|Q9ASQ6\|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card