TkA04G348030 | RubberDandelionOmics

Gene overview

TkA04G348030

Reference: TK1151 Chr: Chr04 Coordinates: 87917845-87924059 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3171 bp · TkA04G348030|TK1151|cDNA

ATGACAGATTTTACTATGGCATCAACGAGGTCATATGCAAATGTCCAAACTTCTTCATCGATAAAATTAGGTTCTGGAACTCATAAACTAAAAAGAAAGGCTACCAATGTAACCTCCATTTCTATGATTGACCTGGCATCCGATGAAGATATTAATGATGAACGTGTTACTGAATCAAATATTGGCGATTACATCGATCATGGAGACCAAACTGTTGAATGTGCAGTATGCCATGCAATGTTATGGAAAGGTGAATCAGC...

CDS

Download CDS FASTA

3171 bp · TkA04G348030|TK1151|CDS

ATGACAGATTTTACTATGGCATCAACGAGGTCATATGCAAATGTCCAAACTTCTTCATCGATAAAATTAGGTTCTGGAACTCATAAACTAAAAAGAAAGGCTACCAATGTAACCTCCATTTCTATGATTGACCTGGCATCCGATGAAGATATTAATGATGAACGTGTTACTGAATCAAATATTGGCGATTACATCGATCATGGAGACCAAACTGTTGAATGTGCAGTATGCCATGCAATGTTATGGAAAGGTGAATCAGC...

Protein

Download Protein FASTA

1056 aa · TkA04G348030|TK1151|PROTEIN

MTDFTMASTRSYANVQTSSSIKLGSGTHKLKRKATNVTSISMIDLASDEDINDERVTESNIGDYIDHGDQTVECAVCHAMLWKGESARSKKKSDGSFSICCNYAKVQLPKLKDAPPTYKNLFRSTDSKAKYFIDNIRRYNSMFSFTSMGGRVDKEVNKSRGPYVYRISGENYHRLGSLLPPDESQPKFSQLYIYDTDNEISNRQHIFSRPQDASTSRSTSADLDVIKFLQEMLDANNELVKSYKMVRDSFHADPHINLKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G348030`
TK1151 ID	TkA04G348030
OH-1004 ID	LXL04_030158
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.100
Protein coverage (%)	TK1151 88.920 / OH-1004 99.541 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G348030`
Location	Chr04:87917845-87924059 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030158` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · TkA04G348030 · TK1151

Cytoplasm0.130

Rank 2 · TkA04G348030 · TK1151

Mitochondrion0.039

Rank 3 · TkA04G348030 · TK1151

Cell membrane0.013

Rank 4 · TkA04G348030 · TK1151

Extracellular0.009

Rank 5 · TkA04G348030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14214Helitron_like_N358-393 aa

PF20199RepSA402-424 aa

PF23343REP_ORF2-G2P403-435 aa

PF14214Helitron_like_N405-422 aa

PF23343REP_ORF2-G2P537-562 aa

PF20199RepSA547-568 aa

PF05970PIF1883-949 aa

PF13481AAA_25902-990 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G348030	`PF14214`	Helitron_like_N	358	393	6.4e-08	33.7
TkA04G348030	`PF20199`	RepSA	402	424	0.061	13.2
TkA04G348030	`PF23343`	REP_ORF2-G2P	403	435	2.7e-05	25.0
TkA04G348030	`PF14214`	Helitron_like_N	405	422	6.4e-08	33.7
TkA04G348030	`PF23343`	REP_ORF2-G2P	537	562	2.7e-05	25.0
TkA04G348030	`PF20199`	RepSA	547	568	0.061	13.2
TkA04G348030	`PF05970`	PIF1	883	949	3.7e-24	86.3
TkA04G348030	`PF13481`	AAA_25	902	990	0.18	12.1
TkA04G348030	`PF20199`	RepSA	995	1025	0.061	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card