TkA04G345120 | RubberDandelionOmics

Gene overview

TkA04G345120

Reference: TK1151 Chr: Chr04 Coordinates: 87248825-87257738 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · TkA04G345120|TK1151|cDNA

ATGGCTTCTCCCAATTCCATCCTTTCAATTGCATTTCTACTTTTGCTCACCTTTCAACCACTTTTCACAATTTCCGAAGCTCTTGTGCCCGATTCAGACACCTTCACTTACATAAACGAAGGTGATTTTGGAGAATATATCGTCGAGTACGATGCCGATTATCGTACTCTTCCCCTTGCCAGTAATCCATTCCAGCTTTGTTTCTACAACACCACCCCCAACGCTTTCACTCTAGCTTTACGTATGGGTACAGTCCGATC...

CDS

Download CDS FASTA

1329 bp · TkA04G345120|TK1151|CDS

ATGGCTTCTCCCAATTCCATCCTTTCAATTGCATTTCTACTTTTGCTCACCTTTCAACCACTTTTCACAATTTCCGAAGCTCTTGTGCCCGATTCAGACACCTTCACTTACATAAACGAAGGTGATTTTGGAGAATATATCGTCGAGTACGATGCCGATTATCGTACTCTTCCCCTTGCCAGTAATCCATTCCAGCTTTGTTTCTACAACACCACCCCCAACGCTTTCACTCTAGCTTTACGTATGGGTACAGTCCGATC...

Protein

Download Protein FASTA

442 aa · TkA04G345120|TK1151|PROTEIN

MASPNSILSIAFLLLLTFQPLFTISEALVPDSDTFTYINEGDFGEYIVEYDADYRTLPLASNPFQLCFYNTTPNAFTLALRMGTVRSESLMRWVWEANRGSPVGENATLTFGVDGNLILADSDGRIAWQTNTANKSVVGFQVLPVGNMVLHDDNGTIIWQSFDSPTDTLLVGQSLRVGGANKLVSRVSAEFNIDGPYSLVMEPKQLALYYTTSVEWFNVDVGSVTNGSLINLTLTSVPDTDEGFLYYLTFDYYITNPPSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G345120`
TK1151 ID	TkA04G345120
OH-1004 ID	LXL04_037752
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.200
Protein coverage (%)	TK1151 99.548 / OH-1004 66.270 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G345120

Location Chr04:87248825-87257738 (-)

Description Similar to At1g78860: EP1-like glycoprotein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78860`	EP1-like glycoprotein 4.	No verified direct reference in this release
`At1g78850`	May be involved in a cell-to cell programmed cell death (PCD) signaling mechanism.	No verified direct reference in this release
`At1g78830`	EP1-like glycoprotein 2.	No verified direct reference in this release
`At1g78820`	EP1-like glycoprotein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037752 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1904383 response to sodium phosphate Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005539 glycosaminoglycan binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G78850

ath:AT1G78860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.432

Rank 1 · TkA04G345120 · TK1151

Cell membrane0.280

Rank 2 · TkA04G345120 · TK1151

Endoplasmic reticulum0.117

Rank 3 · TkA04G345120 · TK1151

Cytoplasm0.072

Rank 4 · TkA04G345120 · TK1151

Plastid0.051

Rank 5 · TkA04G345120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin94-181 aa

PF29654YonV_mid114-135 aa

PF29654YonV_mid141-164 aa

PF00954S_locus_glycop227-346 aa

PF01453B_lectin271-289 aa

PF08276PAN_2386-418 aa

PF00954S_locus_glycop392-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G345120	`PF01453`	B_lectin	94	181	5.6e-18	66.0
TkA04G345120	`PF29654`	YonV_mid	114	135	0.25	12.0
TkA04G345120	`PF29654`	YonV_mid	141	164	0.25	12.0
TkA04G345120	`PF00954`	S_locus_glycop	227	346	0.0022	19.2
TkA04G345120	`PF01453`	B_lectin	271	289	5.6e-18	66.0
TkA04G345120	`PF08276`	PAN_2	386	418	0.0039	18.0
TkA04G345120	`PF00954`	S_locus_glycop	392	408	0.0022	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVA5`	Arabidopsis thaliana	sp\|Q9ZVA5\|EP1L4_ARATH EP1-like glycoprotein 4	49.300%	Swiss-Prot	Medium
`Q9ZVA4`	Arabidopsis thaliana	sp\|Q9ZVA4\|EP1L3_ARATH EP1-like glycoprotein 3	48.200%	Swiss-Prot	Medium
`Q9ZVA2`	Arabidopsis thaliana	sp\|Q9ZVA2\|EP1L2_ARATH EP1-like glycoprotein 2	47.100%	Swiss-Prot	Medium
`Q9ZVA1`	Arabidopsis thaliana	sp\|Q9ZVA1\|EP1L1_ARATH EP1-like glycoprotein 1	44.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card