TkA04G343390 | RubberDandelionOmics

Gene overview

TkA04G343390

Reference: TK1151 Chr: Chr04 Coordinates: 86769822-86773726 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

1197 bp · TkA04G343390|TK1151|CDS

ATGTCAGATTATCTATGCGAAGAGTTGATTGATGAAATATTTACAAGACTACCTTCCAAAACCCTCCTGCGATTTAGATCACTCTCAAAATCGTTATGGAGTTCTATTTCTAGCCCCGGTTTCATACGCATGCACACTTTTCGATCCCCACAAAAAATCTGTTTCAGGCATGTCAATGACAAAGAAAGATCCTCTTTTTATACATTACATGGAGAAGACGAATTGCCATTGTGTTTGTGTCCGCAACGCGGATACATTGG...

Protein

Download Protein FASTA

399 aa · TkA04G343390|TK1151|PROTEIN

MSDYLCEELIDEIFTRLPSKTLLRFRSLSKSLWSSISSPGFIRMHTFRSPQKICFRHVNDKERSSFYTLHGEDELPLCLCPQRGYIGITTALPIPSDISGTIRLCNGTFCFQTKKGFSLWNPSIRRKLNIPQCAHRSDPLLEEIGFGFDPLNDDYQIVWFSCAKGKENSYVYAMKTGAWCEIASPKPQFTRFSWVDSFSFNGVLHWKVGQSLSKPQDGSFFYIMTFDLSTHVFGMIPLPGPNYDWMTTNITTFKDSLALV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G343390`
TK1151 ID	TkA04G343390
OH-1004 ID	LXL04_037729
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.000
Protein coverage (%)	TK1151 71.930 / OH-1004 76.630 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G343390

Location Chr04:86769822-86773726 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release
`At3g52320`	Putative F-box protein At3g52320.	No verified direct reference in this release
`At1g11620`	Putative F-box/LRR-repeat/kelch-repeat protein At1g11620.	No verified direct reference in this release
`At4g21240`	Putative F-box protein At4g21240.	No verified direct reference in this release
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037729 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G16210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA04G343390 · TK1151

Nucleus0.408

Rank 2 · TkA04G343390 · TK1151

Cell membrane0.157

Rank 3 · TkA04G343390 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA04G343390 · TK1151

Lysosome / Vacuole0.038

Rank 5 · TkA04G343390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-39 aa

PF08268FBA_3100-277 aa

PF07734FBA_1102-274 aa

PF03478Beta-prop_KIB1-4104-235 aa

PF11178DUF2963216-230 aa

PF07734FBA_1306-328 aa

PF11178DUF2963314-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G343390	`PF00646`	F-box	5	39	8.6e-05	23.0
TkA04G343390	`PF08268`	FBA_3	100	277	2.5e-16	60.3
TkA04G343390	`PF07734`	FBA_1	102	274	1e-14	55.0
TkA04G343390	`PF03478`	Beta-prop_KIB1-4	104	235	0.0016	18.7
TkA04G343390	`PF11178`	DUF2963	216	230	0.012	15.7
TkA04G343390	`PF07734`	FBA_1	306	328	1e-14	55.0
TkA04G343390	`PF11178`	DUF2963	314	341	0.012	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU24`	Arabidopsis thaliana	sp\|Q9LU24\|FB145_ARATH Putative F-box protein At3g16210	31.200%	Swiss-Prot	Medium
`Q9FT50`	Arabidopsis thaliana	sp\|Q9FT50\|FB202_ARATH Putative F-box protein At3g52320	24.600%	Swiss-Prot	Low
`Q9SAB5`	Arabidopsis thaliana	sp\|Q9SAB5\|FBLK2_ARATH Putative F-box/LRR-repeat/kelch-repeat protein At1g11620	24.000%	Swiss-Prot	Low
`O49565`	Arabidopsis thaliana	sp\|O49565\|FB239_ARATH Putative F-box protein At4g21240	30.500%	Swiss-Prot	Low
`Q9SXA0`	Arabidopsis thaliana	sp\|Q9SXA0\|FB42_ARATH Putative F-box protein At1g47730	22.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card