TkA04G336470 | RubberDandelionOmics

Gene overview

TkA04G336470

Reference: TK1151 Chr: Chr04 Coordinates: 84995938-84997614 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

711 bp · TkA04G336470|TK1151|cDNA

ATGCTTTGTCAAGTTGCTTCTCAAATGTCAATAAAAGTCAACATTCTAGATCCTCTGGTCAACTGTCCTGCAAGTACCATATGCCACGATCATATGGTGGGAAGTTTTGATAATAGCACCACAGTTGAAGAATTTGCTAAGAGGTGTGATATACTGACAGTTGATCTTGAGCATGTTAATGCTGACACTTTGGAGAAGCTTGAAAAACAAGGGGTTGATTGTCAGCCTAAAGCTTCTACCATCCGAATTATTCAGGATAA...

CDS

Download CDS FASTA

711 bp · TkA04G336470|TK1151|CDS

ATGCTTTGTCAAGTTGCTTCTCAAATGTCAATAAAAGTCAACATTCTAGATCCTCTGGTCAACTGTCCTGCAAGTACCATATGCCACGATCATATGGTGGGAAGTTTTGATAATAGCACCACAGTTGAAGAATTTGCTAAGAGGTGTGATATACTGACAGTTGATCTTGAGCATGTTAATGCTGACACTTTGGAGAAGCTTGAAAAACAAGGGGTTGATTGTCAGCCTAAAGCTTCTACCATCCGAATTATTCAGGATAA...

Protein

Download Protein FASTA

236 aa · TkA04G336470|TK1151|PROTEIN

MLCQVASQMSIKVNILDPLVNCPASTICHDHMVGSFDNSTTVEEFAKRCDILTVDLEHVNADTLEKLEKQGVDCQPKASTIRIIQDKFLQKVHFSRHGIPLPKFNQIDDEESAKKAGLEFGYPLMVKSRRLAYDGRGNAVAKSEQELTSAINALGGFGHGLYVEQWAPFVKELDVIVARGRDNSILCYPVVETVHRQDDNILCIVISNSNKLIFNFFCLFINRENICHIVKAPTNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G336470`
TK1151 ID	TkA04G336470
OH-1004 ID	LXL04_016810
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.700
Protein coverage (%)	TK1151 100.000 / OH-1004 32.656 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G336470`
Location	Chr04:84995938-84997614 (-)
Description	Similar to PURKE: Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016810` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006144 purine nucleobase metabolic process Biological Process GO:0006189 'de novo' IMP biosynthetic process Biological Process GO:0009113 purine nucleobase biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0004638 phosphoribosylaminoimidazole carboxylase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	cgr:2890129 sce:YOR128C spo:2538734 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.329

Rank 1 · TkA04G336470 · TK1151

Plastid0.286

Rank 2 · TkA04G336470 · TK1151

Mitochondrion0.251

Rank 3 · TkA04G336470 · TK1151

Peroxisome0.115

Rank 4 · TkA04G336470 · TK1151

Nucleus0.107

Rank 5 · TkA04G336470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22660RS_preATP-grasp-like1-85 aa

PF08442ATP-grasp_254-77 aa

PF08443RimK85-154 aa

PF01071GARS_A87-153 aa

PF02222ATP-grasp93-208 aa

PF08442ATP-grasp_293-154 aa

PF02786CPSase_L_D294-187 aa

PF07478Dala_Dala_lig_C96-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G336470	`PF22660`	RS_preATP-grasp-like	1	85	1.8e-21	77.1
TkA04G336470	`PF08442`	ATP-grasp_2	54	77	0.29	11.4
TkA04G336470	`PF08443`	RimK	85	154	0.034	14.5
TkA04G336470	`PF01071`	GARS_A	87	153	0.0008	20.0
TkA04G336470	`PF02222`	ATP-grasp	93	208	1.3e-29	103.9
TkA04G336470	`PF08442`	ATP-grasp_2	93	154	0.29	11.4
TkA04G336470	`PF02786`	CPSase_L_D2	94	187	0.00018	21.8
TkA04G336470	`PF07478`	Dala_Dala_lig_C	96	192	0.00024	21.4
TkA04G336470	`PF02222`	ATP-grasp	221	234	1.3e-29	103.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card