TkA04G331970 | RubberDandelionOmics

Gene overview

TkA04G331970

Reference: TK1151 Chr: Chr04 Coordinates: 83737421-83739088 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1411 bp · TkA04G331970|TK1151|cDNA

ATTAACACCACGGTCCTACTCCCATATAAAAAAGATCACCTTCTCCTTCTCTCTTTCTCTCTGATCGAAATCTAAATTAACAAAAACTGAAGCAATTTCGTCGATCATGGAGAGCACAGATTCTTCAACGGGTTCTCAATTACTCCAGCTACCGCCGGGGTTCCGCTTCCACCCCACCGACGAAGAGTTGGTGGTTCACTACCTCAAAAAAAGAGCCGCCTCCGCCCCTATTCCGGTGGCGATCATCGCCGAAATCGACC...

CDS

Download CDS FASTA

1056 bp · TkA04G331970|TK1151|CDS

ATGGAGAGCACAGATTCTTCAACGGGTTCTCAATTACTCCAGCTACCGCCGGGGTTCCGCTTCCACCCCACCGACGAAGAGTTGGTGGTTCACTACCTCAAAAAAAGAGCCGCCTCCGCCCCTATTCCGGTGGCGATCATCGCCGAAATCGACCTCTACAAGTTCGATCCATGGGAGCTTCCCGATAAGGCGACATTTGGGGAGCAAGAGTGGTATTTCTTTAGCCCGAGGGACCGGAAATACCCGAACGGAGCGAGACC...

Protein

Download Protein FASTA

351 aa · TkA04G331970|TK1151|PROTEIN

MESTDSSTGSQLLQLPPGFRFHPTDEELVVHYLKKRAASAPIPVAIIAEIDLYKFDPWELPDKATFGEQEWYFFSPRDRKYPNGARPNRAANSGYWKATGTDKPVMTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLTDGKTISKPHGCDPTKPKGSLRLDDWVLCRIYKKNNIQRPMDSDGDDLHNMNGMLASIPPSISLAGGHQGTMGKPNAAMGYNAMLENHEHNLMFDGRINSNDTDTNTSNLLPMKRSMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G331970`
TK1151 ID	TkA04G331970
OH-1004 ID	LXL04_039604
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 97.721 / OH-1004 94.412 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G331970

Location Chr04:83737421-83739088 (+)

Description Similar to NAC056: NAC transcription factor 56

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15510`	Transcription factor of the NAC family (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160
`At1g61110`	Transcription factor of the NAC family.	A cis regulatory element in the TAPNAC promoter directs tapetal gene expression.2011 · DOI: 10.1007/s11103-010-9713-5
`At1g52880`	May encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0566500`	Transcription factor of the NAC family associated with male fertility.	No verified direct reference in this release
`UniProt: A2YMR0`	Transcription factor of the NAC family associated with male fertility.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039604 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0048317 seed morphogenesis Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

GO:0080060 integument development Biological Process

KEGG gene cross-reference

ath:AT1G52880

ath:AT1G61110

ath:AT3G15510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA04G331970 · TK1151

Cytoplasm0.074

Rank 2 · TkA04G331970 · TK1151

Cell membrane0.037

Rank 3 · TkA04G331970 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA04G331970 · TK1151

Plastid0.014

Rank 5 · TkA04G331970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM16-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G331970	`PF02365`	NAM	16	142	5.6e-51	172.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD44`	Arabidopsis thaliana	sp\|Q9LD44\|NAC56_ARATH NAC transcription factor 56	50.000%	Swiss-Prot	High
`Q8GY42`	Arabidopsis thaliana	sp\|Q8GY42\|NAC25_ARATH NAC transcription factor 25	51.400%	Swiss-Prot	High
`Q9ZNU2`	Arabidopsis thaliana	sp\|Q9ZNU2\|NAC18_ARATH NAC domain-containing protein 18	78.000%	Swiss-Prot	Medium
`Q8H4S4`	Oryza sativa subsp. japonica	sp\|Q8H4S4\|NAC10_ORYSJ NAC domain-containing protein 10	56.100%	Swiss-Prot	Medium
`A2YMR0`	Oryza sativa subsp. indica	sp\|A2YMR0\|NAC10_ORYSI NAC transcription factor ONAC010	56.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card