Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1262 bp · TkA04G328260|TK1151|cDNA
TTAGGGAAAAACTCGCATATATTAGATCCTACATCGAGATCTGCGCTTTCTTCCATAATCAATCACGTTTCGTCAAAATACGAATACTTTATTATTGATTTTCCCCACCTAATACAATCGTCGCAGAACACCTCACTCCTTCAATCGATCATCTTCATCTTCGCGTTTTCTTCCAGTTTCTTTATCGAACTCGAAATCACCAGGAAGAGCTTTAAGATGACTCGAAAACAGGAGACGTTGATAGGTTCCGGAGCTTGTGT...
708 bp · TkA04G328260|TK1151|CDS
TTAGGGAAAAACTCGCATATATTAGATCCTACATCGAGATCTGCGCTTTCTTCCATAATCAATCACGTTTCGTCAAAATACGAATACTTTATTATTGATTTTCCCCACCTAATACAATCGTCGCAGAACACCTCACTCCTTCAATCGATCATCTTCATCTTCGCGTTTTCTTCCAGTTTCTTTATCGAACTCGAAATCACCAGGAAGAGCTTTAAGATGACTCGAAAACAGGAGACGTTGATAGGTTCCGGAGCTTGTGT...
Protein
Download Protein FASTA235 aa · TkA04G328260|TK1151|PROTEIN
LGKNSHILDPTSRSALSSIINHVSSKYEYFIIDFPHLIQSSQNTSLLQSIIFIFAFSSSFFIELEITRKSFKMTRKQETLIGSGACVALTVLLALKLVRDHLSNWKKPKEQKAIIVIILMAPIYAVDSYVGLLDIRGSETFFVFLDSIKECYEGLVMAKFLALLYTYLNISISKNIVPDEIKGREIHHSFPMTLFQPHSVRLNHQNLKLLKYNWTWQFVVIRPRVFCCDDSFAIS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G328260 |
|---|---|
| TK1151 ID | TkA04G328260 |
| OH-1004 ID | LXL04_037602 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 64.255 / OH-1004 52.448Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G328260 |
|---|---|
| Location | Chr04:82932285-82934498 (-) |
| Description | Similar to tmem184C: Transmembrane protein 184 homolog DDB_G0279555 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0018992 germ-line sex determination Biological Process GO:0032880 regulation of protein localization Biological Process GO:0051046 regulation of secretion Biological Process GO:0005768 endosome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0030658 transport vesicle membrane Cellular Component GO:0030659 cytoplasmic vesicle membrane Cellular Component GO:0030667 secretory granule membrane Cellular Component GO:0031901 early endosome membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0008201 heparin binding Molecular Function |
| KEGG gene cross-reference | bta:504966 ddi:DDB_G0279555 hsa:202915 mmu:231832 mmu:234463 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03619Solute_trans_a49-57 aaPF03619Solute_trans_a80-225 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G328260 | PF03619 | Solute_trans_a | 49 | 57 | 5.4e-29 | 102.0 |
| TkA04G328260 | PF03619 | Solute_trans_a | 80 | 225 | 5.4e-29 | 102.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.