TkA04G314560 | RubberDandelionOmics

Gene overview

TkA04G314560

Reference: TK1151 Chr: Chr04 Coordinates: 79269904-79278193 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3907 bp · TkA04G314560|TK1151|cDNA

GACTAATTACCATAGTAACCTTTCATGACACATACCATAATACCATATTAGCACCCAAGAGACCAAAAAAGCCGACAGATGATCCATCGCCTGACTGTCAAATACCAGCTGCTGACGGCACACCGAGATCCCGTAACTCGCAACCCACCCATGACCCATCATTCTCACTTCATTTCATCACCTTTAATCCTCCCCACTCATCACCACAATCCATGAGATTCACTTTTCACTTTCCCCTCATTCCTCACCGCCTTTGAGCT...

CDS

Download CDS FASTA

3417 bp · TkA04G314560|TK1151|CDS

ATGGAGTCGATAATTGCAAGGGCGCTGGAGTATACTCTCAAGTACTGGCTTAAATCCTTCACTAGAGATCAGTTCAAGTTACAAGGACGAACTGTTCAGCTCTCGAATTTAGATATAAACGGTGATGCGTTACATGCGAGCCTTGGATTGCCTCCAGCTTTGAATGTTACAACCGCGAAAGTCGGGAAGTTAGAAATTATACTTCCTTATTTGAGCAATGTACAAGTTGAACCTATTGTTGTGCAAATCGATAAACTCGA...

Protein

Download Protein FASTA

1138 aa · TkA04G314560|TK1151|PROTEIN

MESIIARALEYTLKYWLKSFTRDQFKLQGRTVQLSNLDINGDALHASLGLPPALNVTTAKVGKLEIILPYLSNVQVEPIVVQIDKLDLVLEENDDLDAYKSTDSAQTPSTPAKGSGYGFADKIADGMTLEVGTVNLLLETHGGARRRGGATWASPMASITIRNLLLYTTNENWQAVNLKEGRDFSNDKKFIYVFKKLEWEHLSIDLLPHPDMFAAFSEGAFKDDDGAKRVFFGGERFLEGISGEAYITIQRTELNSPLGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G314560`
TK1151 ID	TkA04G314560
OH-1004 ID	LXL04_037506
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G314560`
Location	Chr04:79269904-79278193 (-)
Description	Similar to UHRF1BP1: UHRF1-binding protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037506` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0034498 early endosome to Golgi transport Biological Process GO:0120009 intermembrane lipid transfer Biological Process GO:0005769 early endosome Cellular Component GO:0005829 cytosol Cellular Component GO:0042803 protein homodimerization activity Molecular Function GO:0062069 GARP complex binding Molecular Function GO:0120013 lipid transfer activity Molecular Function
KEGG gene cross-reference	mmu:75089 xla:432006 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.394

Rank 1 · TkA04G314560 · TK1151

Nucleus0.265

Rank 2 · TkA04G314560 · TK1151

Cytoplasm0.238

Rank 3 · TkA04G314560 · TK1151

Golgi apparatus0.213

Rank 4 · TkA04G314560 · TK1151

Cell membrane0.148

Rank 5 · TkA04G314560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13329ATG2_CAD30-95 aa

PF24917BLTP3A_B32-205 aa

PF10393Matrilin_ccoil1112-1134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G314560	`PF13329`	ATG2_CAD	30	95	5.7e-05	21.7
TkA04G314560	`PF24917`	BLTP3A_B	32	205	5e-08	31.4
TkA04G314560	`PF10393`	Matrilin_ccoil	1112	1134	0.27	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card