TkA04G314320 | RubberDandelionOmics

Gene overview

TkA04G314320

Reference: TK1151 Chr: Chr04 Coordinates: 79175863-79176675 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

783 bp · TkA04G314320|TK1151|cDNA

ATGGCAAAGCTTATAGCACTCGCACTCGCCTTCTCAGCCTTCCTAGCCCTAACTTCCGCCCACACCACCATCATCACCACCACCATCGAGGAAGAAAAACCAGTCTCCCGACAACAATGCAGCCGACAAATCCAGGGACAGAGACTTAACCAGTGTCAAAGGTACCTGCAACAAGGTCAGAGTTGGTACGAGGAAGACAACCGGAGCCAAATGCAGGGCGGCGGCCTCCAGTCATGCTGCCAAGAGCTCCAAAACGTGGA...

CDS

Download CDS FASTA

783 bp · TkA04G314320|TK1151|CDS

ATGGCAAAGCTTATAGCACTCGCACTCGCCTTCTCAGCCTTCCTAGCCCTAACTTCCGCCCACACCACCATCATCACCACCACCATCGAGGAAGAAAAACCAGTCTCCCGACAACAATGCAGCCGACAAATCCAGGGACAGAGACTTAACCAGTGTCAAAGGTACCTGCAACAAGGTCAGAGTTGGTACGAGGAAGACAACCGGAGCCAAATGCAGGGCGGCGGCCTCCAGTCATGCTGCCAAGAGCTCCAAAACGTGGA...

Protein

Download Protein FASTA

260 aa · TkA04G314320|TK1151|PROTEIN

MAKLIALALAFSAFLALTSAHTTIITTTIEEEKPVSRQQCSRQIQGQRLNQCQRYLQQGQSWYEEDNRSQMQGGGLQSCCQELQNVEEQCQCEAVKEAFRQTQRMQQRGSFGAQQIRELKQKAQELPNQCKLQTRQCQVGPISVTTTTTFTEETMTNPRGGSQMCQHIRGRRFNQCQTFIERQMGTLLMSMSRKGQETQGVEQCCNELRNVEEECQFEQMERQGRRQGGRQMLDMRQMVENLRDQCKLQVQQCRIPSTMF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G314320`
TK1151 ID	TkA04G314320
OH-1004 ID	LXL04_039831
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G314320`
Location	Chr04:79175863-79176675 (+)
Description	Similar to HAG5: 2S seed storage protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039831` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002229 defense response to oomycetes Biological Process GO:0009555 pollen development Biological Process GO:0031640 killing of cells of another organism Biological Process GO:0050832 defense response to fungus Biological Process GO:0000322 storage vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0033095 aleurone grain Cellular Component GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	ath:AT5G54740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.453

Rank 1 · TkA04G314320 · TK1151

Cytoplasm0.299

Rank 2 · TkA04G314320 · TK1151

Nucleus0.148

Rank 3 · TkA04G314320 · TK1151

Endoplasmic reticulum0.130

Rank 4 · TkA04G314320 · TK1151

Lysosome / Vacuole0.119

Rank 5 · TkA04G314320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05617Prolamin_like35-40 aa

PF00234Tryp_alpha_amyl36-53 aa

PF00234Tryp_alpha_amyl40-137 aa

PF12934FTO_CTD50-126 aa

PF05617Prolamin_like77-130 aa

PF08615RNase_H2_suC147-217 aa

PF12934FTO_CTD167-194 aa

PF00234Tryp_alpha_amyl176-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G314320	`PF05617`	Prolamin_like	35	40	0.00048	20.9
TkA04G314320	`PF00234`	Tryp_alpha_amyl	36	53	3.9e-10	40.5
TkA04G314320	`PF00234`	Tryp_alpha_amyl	40	137	3.9e-10	40.5
TkA04G314320	`PF12934`	FTO_CTD	50	126	1.3	9.5
TkA04G314320	`PF05617`	Prolamin_like	77	130	0.00048	20.9
TkA04G314320	`PF08615`	RNase_H2_suC	147	217	2.5	9.2
TkA04G314320	`PF12934`	FTO_CTD	167	194	1.3	9.5
TkA04G314320	`PF00234`	Tryp_alpha_amyl	176	253	3.9e-10	40.5
TkA04G314320	`PF05617`	Prolamin_like	201	222	0.00048	20.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card