TkA04G308920 | RubberDandelionOmics

Gene overview

TkA04G308920

Reference: TK1151 Chr: Chr04 Coordinates: 77923867-77925962 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

717 bp · TkA04G308920|TK1151|cDNA

ATGGCACTAGCTAGAGAAGGAGGTCATATGGCGTATCAAGTCCCCGTTATAACCCCAATAAAATATCCGGTGTGGGCGGTCAAAGTGAAATCCATTATGGATGCTCACGGTATATGGGAGACGGTCGATGTAAGGGTGTTAGGCGAAGAAGTTGATCCAAAGAAGAAGAAACAAGCACTTGCTTTCTTGTTTCAAGCTATACCGGAAGATATGGTGTTGCAAATGGCGAGTTACACAGATCCAAAACAAGTGTGGGATGG...

CDS

Download CDS FASTA

717 bp · TkA04G308920|TK1151|CDS

ATGGCACTAGCTAGAGAAGGAGGTCATATGGCGTATCAAGTCCCCGTTATAACCCCAATAAAATATCCGGTGTGGGCGGTCAAAGTGAAATCCATTATGGATGCTCACGGTATATGGGAGACGGTCGATGTAAGGGTGTTAGGCGAAGAAGTTGATCCAAAGAAGAAGAAACAAGCACTTGCTTTCTTGTTTCAAGCTATACCGGAAGATATGGTGTTGCAAATGGCGAGTTACACAGATCCAAAACAAGTGTGGGATGG...

Protein

Download Protein FASTA

238 aa · TkA04G308920|TK1151|PROTEIN

MALAREGGHMAYQVPVITPIKYPVWAVKVKSIMDAHGIWETVDVRVLGEEVDPKKKKQALAFLFQAIPEDMVLQMASYTDPKQVWDGLKTRYLGVDRVRTARVATLKRELEGLRMKEDETIDNFVTKLSGLASKAMSLGYKIEEAVGRLMAYEDRIKGTEKTEDVQGSLLLASGENSNVCKHCGNGGSNRDGFGRGRGRGRGSGKGRDDPLVPETVYRRMRKSSDGVLVVPYSSGLFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G308920`
TK1151 ID	TkA04G308920
OH-1004 ID	LXL04_037444
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 81.933 / OH-1004 77.075 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G308920`
Location	Chr04:77923867-77925962 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037444` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.460

Rank 1 · TkA04G308920 · TK1151

Cytoplasm0.375

Rank 2 · TkA04G308920 · TK1151

Mitochondrion0.075

Rank 3 · TkA04G308920 · TK1151

Peroxisome0.060

Rank 4 · TkA04G308920 · TK1151

Cell membrane0.046

Rank 5 · TkA04G308920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11153DUF293110-82 aa

PF13961DUF421922-42 aa

PF14223Retrotran_gag_232-145 aa

PF13961DUF421982-86 aa

PF24434DUF7557108-128 aa

PF24434DUF7557143-151 aa

PF25698EBNA2_Core189-210 aa

PF11153DUF2931192-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G308920	`PF11153`	DUF2931	10	82	0.048	14.1
TkA04G308920	`PF13961`	DUF4219	22	42	0.00028	21.2
TkA04G308920	`PF14223`	Retrotran_gag_2	32	145	4.7e-12	46.7
TkA04G308920	`PF13961`	DUF4219	82	86	0.00028	21.2
TkA04G308920	`PF24434`	DUF7557	108	128	0.057	13.6
TkA04G308920	`PF24434`	DUF7557	143	151	0.057	13.6
TkA04G308920	`PF25698`	EBNA2_Core	189	210	0.16	11.6
TkA04G308920	`PF11153`	DUF2931	192	216	0.048	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card