TkA04G308210 | RubberDandelionOmics

Gene overview

TkA04G308210

Reference: TK1151 Chr: Chr04 Coordinates: 77746863-77758021 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1619 bp · TkA04G308210|TK1151|cDNA

AAGGGGTTGAATGTGTAAGTTTGTATGAAACTTGGAGTGAAAAGATGTCTTCTTCTTATTCGGACCAGATGAAACCAGCTGATTTTCACACTCTGTCCGAAAAAGCGCAGCTGAAAATGGAGCTAAATAAGCTGAAAATACTGTTACCGTTAATGGCGGTGCTTACGGTGGTCTCCGCCGTAACCGTAACAGCTGATTACATCCGGCCACCGCCTCGAAAGGACTTACAGTTTCCGTGGGATCCGAAGCCGTCCTCTCAA...

CDS

Download CDS FASTA

1395 bp · TkA04G308210|TK1151|CDS

ATGTCTTCTTCTTATTCGGACCAGATGAAACCAGCTGATTTTCACACTCTGTCCGAAAAAGCGCAGCTGAAAATGGAGCTAAATAAGCTGAAAATACTGTTACCGTTAATGGCGGTGCTTACGGTGGTCTCCGCCGTAACCGTAACAGCTGATTACATCCGGCCACCGCCTCGAAAGGACTTACAGTTTCCGTGGGATCCGAAGCCGTCCTCTCAACCTCAACAGGTTCACATCTCATTAGCAGGCGACCAACAAATCCG...

Protein

Download Protein FASTA

464 aa · TkA04G308210|TK1151|PROTEIN

MSSSYSDQMKPADFHTLSEKAQLKMELNKLKILLPLMAVLTVVSAVTVTADYIRPPPRKDLQFPWDPKPSSQPQQVHISLAGDQQIRVTWTTTKSSSPSLVEYGTSPGKYTSRSHGHTTSYTYLLYTSGTIHHTVIGPLQPNTIYYYKCGGQGREFTLKTPPSNLPITLAVAGDLGQTGWTKSTLDHIDLCQYDLHLVPGDLSYADYVQSRWDTFGELVEPLASGRPWMVTQGNHEKENIPFFKDGFEAYNARWKMPYEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G308210`
TK1151 ID	TkA04G308210
OH-1004 ID	LXL04_014820
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.100
Protein coverage (%)	TK1151 87.284 / OH-1004 87.473 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G308210

Location Chr04:77746863-77758021 (+)

Description Similar to PAP22: Purple acid phosphatase 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20500`	Purple acid phosphatase 18.	No verified direct reference in this release
`At3g52820`	Purple acid phosphatase 22.	No verified direct reference in this release
`At3g52780`	Probable purple acid phosphatase 20.	No verified direct reference in this release
`At3g52810`	Purple acid phosphatase 21.	No verified direct reference in this release
`At3g07130`	Acid phosphatase activity with p-nitrophenyl phosphate (pNPP), D-myoinositol 1-phosphate (Ins(1)P1), phytic acid and Myo- inositol hexakisphosphate.	An Arabidopsis purple acid phosphatase with phytase activity increases foliar ascorbate.2008 · DOI: 10.1104/pp.107.109934

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014820 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006796 phosphate-containing compound metabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G20500

ath:AT3G52780

ath:AT3G52810

ath:AT3G52820

ath:AT4G36350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.458

Rank 1 · TkA04G308210 · TK1151

Extracellular0.199

Rank 2 · TkA04G308210 · TK1151

Cell membrane0.189

Rank 3 · TkA04G308210 · TK1151

Cytoplasm0.166

Rank 4 · TkA04G308210 · TK1151

Endoplasmic reticulum0.129

Rank 5 · TkA04G308210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656Pur_ac_phosph_N73-155 aa

PF00149Metallophos168-358 aa

PF09587PGA_cap248-369 aa

PF16656Pur_ac_phosph_N283-295 aa

PF14008Metallophos_C373-431 aa

PF16656Pur_ac_phosph_N416-430 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G308210	`PF16656`	Pur_ac_phosph_N	73	155	1.2e-20	74.6
TkA04G308210	`PF00149`	Metallophos	168	358	2e-19	71.5
TkA04G308210	`PF09587`	PGA_cap	248	369	0.068	13.4
TkA04G308210	`PF16656`	Pur_ac_phosph_N	283	295	1.2e-20	74.6
TkA04G308210	`PF14008`	Metallophos_C	373	431	5.8e-21	75.6
TkA04G308210	`PF16656`	Pur_ac_phosph_N	416	430	1.2e-20	74.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJU7`	Arabidopsis thaliana	sp\|Q9LJU7\|PPA18_ARATH Purple acid phosphatase 18	70.300%	Swiss-Prot	High
`Q8S340`	Arabidopsis thaliana	sp\|Q8S340\|PPA22_ARATH Purple acid phosphatase 22	59.600%	Swiss-Prot	High
`Q9LXI7`	Arabidopsis thaliana	sp\|Q9LXI7\|PPA20_ARATH Probable purple acid phosphatase 20	57.300%	Swiss-Prot	High
`Q9LXI4`	Arabidopsis thaliana	sp\|Q9LXI4\|PPA21_ARATH Purple acid phosphatase 21	57.900%	Swiss-Prot	High
`Q9SFU3`	Arabidopsis thaliana	sp\|Q9SFU3\|PPA15_ARATH Purple acid phosphatase 15	39.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card