TkA04G305880 | RubberDandelionOmics

Gene overview

TkA04G305880

Reference: TK1151 Chr: Chr04 Coordinates: 77234860-77238550 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2662 bp · TkA04G305880|TK1151|cDNA

CAATTATTTAGTCAACAGTGACCTGGTGTAGTTACCCACTTGCTGGTTCGATTGCTTTTTGGTCGGTATTTTACGTCCGTTTATTTATCCACTATTTTCAACCTGCCGCTTTATCTTTTTGCTTCGTTCCTCCGGCGAACTTGACCGGCGTTCTTTACTCACTTTGCCGGACGTTCTCCAAACACAGGGATCGAACTATTTTAGGGATCTCAACGATTGTTCTCTCAGGAAGTGGATTTTGTGAATTATTAAAGTGTCGC...

CDS

Download CDS FASTA

1839 bp · TkA04G305880|TK1151|CDS

ATGAAAGAGTTCGAGCACCTTAGAGTACCACTTGACTTCATAAAACATGCCACCAACAACTTTGGTGCGACCAACTTCATCGCCGAAGGTGGATTCGGAAAGGTATACAAAGGAGAATTTCAAGGAGAAGTGTTTTTCCACTCTGAGGGCCGGAATATTGGTGCTGTAAAGATCTTGGATCGATCAAAAGATCAAGCAGATGTTTCATTTTGGAGAGAGATCATGTTGCTATCCAGTTATCGTCATGAAAATATCATCTC...

Protein

Download Protein FASTA

612 aa · TkA04G305880|TK1151|PROTEIN

MKEFEHLRVPLDFIKHATNNFGATNFIAEGGFGKVYKGEFQGEVFFHSEGRNIGAVKILDRSKDQADVSFWREIMLLSSYRHENIISLLGFCDECDKRIIVYEYASNKSLDFHLCSPDLTWLQRLKICLGAACGLQYLHDPRGTQQRVLHRDIKSANILLDENWNAKIADFGLSKHGPANQQYTFLFSEAKGTLGYCDPMYVETMLLTKESDVYSFGVVLFEVLCSRHCVDYSYNDERRSLPVLVKKCYREKSLHTIIDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G305880`
TK1151 ID	TkA04G305880
OH-1004 ID	LXL04_037425
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 50.000 / OH-1004 23.502 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G305880

Location Chr04:77234860-77238550 (-)

Description Similar to CPK9: Calcium-dependent protein kinase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22280`	Involved in the regulation of phytochrome signaling.	No verified direct reference in this release
`At1g34750`	Probable protein phosphatase 2C 10.	No verified direct reference in this release
`At1g78200`	Probable protein phosphatase 2C 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q7XQU7`	Probable protein phosphatase 2C 41.	No verified direct reference in this release
`Os04g0609600`	Probable protein phosphatase 2C 44.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037425 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G50700

ath:AT3G20410

dosa:Os07g0515100

osa:4343373

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.412

Rank 1 · TkA04G305880 · TK1151

Cell membrane0.392

Rank 2 · TkA04G305880 · TK1151

Nucleus0.283

Rank 3 · TkA04G305880 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA04G305880 · TK1151

Golgi apparatus0.052

Rank 5 · TkA04G305880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr26-298 aa

PF00069Pkinase27-296 aa

PF18439zf_UBZ91-103 aa

PF01636APH141-179 aa

PF03109ABC1145-183 aa

PF03109ABC1258-287 aa

PF00481PP2C374-605 aa

PF18439zf_UBZ380-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G305880	`PF07714`	PK_Tyr_Ser-Thr	26	298	1.2e-42	146.8
TkA04G305880	`PF00069`	Pkinase	27	296	2.1e-40	139.5
TkA04G305880	`PF18439`	zf_UBZ	91	103	0.25	11.7
TkA04G305880	`PF01636`	APH	141	179	0.14	12.6
TkA04G305880	`PF03109`	ABC1	145	183	0.21	11.4
TkA04G305880	`PF03109`	ABC1	258	287	0.21	11.4
TkA04G305880	`PF00481`	PP2C	374	605	1.4e-53	182.9
TkA04G305880	`PF18439`	zf_UBZ	380	386	0.25	11.7
TkA04G305880	`PF03109`	ABC1	413	434	0.21	11.4
TkA04G305880	`PF07714`	PK_Tyr_Ser-Thr	565	585	1.2e-42	146.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LME4`	Arabidopsis thaliana	sp\|Q9LME4\|P2C09_ARATH Probable protein phosphatase 2C 9	74.800%	Swiss-Prot	Low
`Q9S9Z7`	Arabidopsis thaliana	sp\|Q9S9Z7\|P2C10_ARATH Probable protein phosphatase 2C 10	74.200%	Swiss-Prot	Low
`Q8L7I4`	Arabidopsis thaliana	sp\|Q8L7I4\|P2C17_ARATH Probable protein phosphatase 2C 17	68.700%	Swiss-Prot	Low
`Q7XQU7`	Oryza sativa subsp. japonica	sp\|Q7XQU7\|P2C41_ORYSJ Probable protein phosphatase 2C 41	70.800%	Swiss-Prot	Low
`Q0JAA0`	Oryza sativa subsp. japonica	sp\|Q0JAA0\|P2C44_ORYSJ Probable protein phosphatase 2C 44	61.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card