TkA04G304290 | RubberDandelionOmics

Gene overview

TkA04G304290

Reference: TK1151 Chr: Chr04 Coordinates: 76852424-76852822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA04G304290|TK1151|cDNA

ATGGAGGAAATGAAGGGTCTCGAGGTTCTCCTCGATGGCTCTGTAAACGTAAAGCAACTTGCATTCAAAGCGAATAGGTTAAATGCCGAGTGCATGAAAGAATTATCGAAGATATTGAGGAAAAATGAAACGATTAAAGAGGTTATTTTGTCTGAATCGAGAATTGGTTCACTTGGAGCTACACTCATTGCTTCAGCTTTGAAGGTGAACTCATGTTTAGAAGAATTGCAGATATGGGAAGATGCAGTCGGATCAAAAGG...

CDS

Download CDS FASTA

399 bp · TkA04G304290|TK1151|CDS

ATGGAGGAAATGAAGGGTCTCGAGGTTCTCCTCGATGGCTCTGTAAACGTAAAGCAACTTGCATTCAAAGCGAATAGGTTAAATGCCGAGTGCATGAAAGAATTATCGAAGATATTGAGGAAAAATGAAACGATTAAAGAGGTTATTTTGTCTGAATCGAGAATTGGTTCACTTGGAGCTACACTCATTGCTTCAGCTTTGAAGGTGAACTCATGTTTAGAAGAATTGCAGATATGGGAAGATGCAGTCGGATCAAAAGG...

Protein

Download Protein FASTA

132 aa · TkA04G304290|TK1151|PROTEIN

MEEMKGLEVLLDGSVNVKQLAFKANRLNAECMKELSKILRKNETIKEVILSESRIGSLGATLIASALKVNSCLEELQIWEDAVGSKGAEELSKMIEANSTLKLLIIFDSSSITATPLNLFRRWKITNKPLTH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G304290`
TK1151 ID	TkA04G304290
OH-1004 ID	LXL04_037417
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G304290`
Location	Chr04:76852424-76852822 (-)
Description	Similar to TRN1: Protein TORNADO 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037417` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001659 temperature homeostasis Biological Process GO:0002221 pattern recognition receptor signaling pathway Biological Process GO:0002253 activation of immune response Biological Process GO:0002606 positive regulation of dendritic cell antigen processing and presentation Biological Process GO:0002720 positive regulation of cytokine production involved in immune response Biological Process GO:0002830 positive regulation of type 2 immune response Biological Process GO:0006914 autophagy Biological Process GO:0006952 defense response Biological Process GO:0006963 positive regulation of antibacterial peptide biosynthetic process Biological Process GO:0006965 positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria Biological Process GO:0007165 signal transduction Biological Process GO:0007249 canonical NF-kappaB signal transduction Biological Process
KEGG gene cross-reference	ath:AT5G55540 mmu:268857 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.597

Rank 1 · TkA04G304290 · TK1151

Cytoplasm0.446

Rank 2 · TkA04G304290 · TK1151

Mitochondrion0.055

Rank 3 · TkA04G304290 · TK1151

Cell membrane0.030

Rank 4 · TkA04G304290 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA04G304290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27087LRR_TMOD-LMOD11-102 aa

PF29255LRR_NLRC317-107 aa

PF29265LRR_CARMIL18-60 aa

PF13516LRR_641-64 aa

PF29265LRR_CARMIL59-117 aa

PF13516LRR_670-91 aa

PF13516LRR_698-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G304290	`PF27087`	LRR_TMOD-LMOD	11	102	1.1e-08	35.6
TkA04G304290	`PF29255`	LRR_NLRC3	17	107	6.1e-13	49.0
TkA04G304290	`PF29265`	LRR_CARMIL	18	60	3.1e-08	33.5
TkA04G304290	`PF13516`	LRR_6	41	64	0.099	13.5
TkA04G304290	`PF29265`	LRR_CARMIL	59	117	3.1e-08	33.5
TkA04G304290	`PF13516`	LRR_6	70	91	0.099	13.5
TkA04G304290	`PF13516`	LRR_6	98	107	0.099	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card