TkA04G277530 | RubberDandelionOmics

Gene overview

TkA04G277530

Reference: TK1151 Chr: Chr04 Coordinates: 69985108-69989032 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2005 bp · TkA04G277530|TK1151|cDNA

CAGAGTTCAAAATCATAATAAAAAAACGGGAGCAAAAAACGGGCGCGCTTAATTCCAGTTCATGTGCGACTTTCTGTCTTTCTCCATCGAAACCCCCCAATCGTCGATCGTTTTCTCTGTTTCGAAAAGTTAGGGTTCCGATCGACAATCGCCGTGGTTCTTCTCTACTTCGATAAGCTATGCTTCCAGCCGACTGCTAGGGTTCCACGACTGCTGCGGGGTGGGTTCTGTTCTTCCACAGAGAGGGTTCGACCACTGCT...

CDS

Download CDS FASTA

462 bp · TkA04G277530|TK1151|CDS

ATGAAAAGGCTTTTGATCCAAAACTTGTTGTGTCATTGTATCAACTCAAGGGAATTGGATGAGTTTGATGAACATCTTGACAATTTACTGCTTGAAGATGGAACAGATGAGAAAAATGATGTAACAAAGGGTCCTAAATCTCGAGATAAGGATTATAGATCAGATAAAAGGGGACAATGGATACTCACCCAAAGAATGAGGAACTACAGAAGCCGAACAGAATGCAGGGGTGACATCCAAAGGCTAAATCTGTCTTTTCT...

Protein

Download Protein FASTA

153 aa · TkA04G277530|TK1151|PROTEIN

MKRLLIQNLLCHCINSRELDEFDEHLDNLLLEDGTDEKNDVTKGPKSRDKDYRSDKRGQWILTQRMRNYRSRTECRGDIQRLNLSFLTIYESLIPPNEEKEKQKQLMALLDKHVKKNGLKPGYFFMDHVPIRSVFVKVTLMFTLQWEMQILLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G277530`
TK1151 ID	TkA04G277530
OH-1004 ID	LXL04_037350
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 79.085 / OH-1004 27.816 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G277530

Location Chr04:69985108-69989032 (+)

Description Similar to URT1: UTP:RNA uridylyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45620`	UTP:RNA uridylyltransferase with a marked preference for uridine polymerization and a distributive activity for the first added nucleotides.	Uridylation prevents 3' trimming of oligoadenylated mRNAs.2013 · DOI: 10.1093/nar/gkt465 Synergistic and independent actions of multiple terminal nucleotidyl transferases in the 3' tailing of small RNAs in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005091 Distinct and cooperative activities of HESO1 and URT1 nucleotidyl transferases in microRNA turnover in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005119 Uridylation and PABP Cooperate to Repair mRNA Deadenylated Ends in Arabidopsis.2016 · DOI: 10.1016/j.celrep.2016.02.060 A genetics screen highlights emerging roles for CPL3, RST1 and URT1 in RNA metabolism and silencing.2019 · DOI: 10.1038/s41477-019-0419-7 The TUTase URT1 connects decapping activators and prevents the accumulation of excessively deadenylated mRNAs to avoid siRNA biogenesis.2021 · DOI: 10.1038/s41467-021-21382-2

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037350 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:0006397 mRNA processing Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010586 miRNA metabolic process Biological Process

GO:0010587 miRNA catabolic process Biological Process

GO:0010605 negative regulation of macromolecule metabolic process Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0031054 pre-miRNA processing Biological Process

GO:0031123 RNA 3'-end processing Biological Process

GO:0141008 transposable element silencing by mRNA destabilization Biological Process

GO:1900369 negative regulation of post-transcriptional gene silencing by regulatory ncRNA Biological Process

GO:1990074 polyuridylation-dependent mRNA catabolic process Biological Process

KEGG gene cross-reference

ath:AT2G45620

hsa:23318

hsa:79670

mmu:214290

spo:2539762

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.266

Rank 1 · TkA04G277530 · TK1151

Cytoplasm0.260

Rank 2 · TkA04G277530 · TK1151

Mitochondrion0.209

Rank 3 · TkA04G277530 · TK1151

Extracellular0.167

Rank 4 · TkA04G277530 · TK1151

Endoplasmic reticulum0.146

Rank 5 · TkA04G277530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18119RIG-I_C14-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G277530	`PF18119`	RIG-I_C	14	99	0.012	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64642`	Arabidopsis thaliana	sp\|O64642\|URT1_ARATH UTP:RNA uridylyltransferase 1	49.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card