TkA04G273850 | RubberDandelionOmics

Gene overview

TkA04G273850

Reference: TK1151 Chr: Chr04 Coordinates: 69180895-69182036 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA04G273850|TK1151|cDNA

ATGCACAACATTTTTTTGGAATACAATGATGAAATAGTACATGAATGGCCAGCTCAGATGCAACAAACAAACAGTATGGGACCATTTGTTTCTGATTTTTTTATCAATGGTATCATTCTTAAATTCCTTGTACATTCTTTACTTCTCTCTGCATTATTATCAAATGATAAAGAGTTGTTTCAGTTGATTTTGGCTCCAGATTGGTATTGGGGGGAGAGTCAAACCGGATACATGTCTGCAAGCTTCTGTATTCAGATGGT...

CDS

Download CDS FASTA

525 bp · TkA04G273850|TK1151|CDS

ATGCACAACATTTTTTTGGAATACAATGATGAAATAGTACATGAATGGCCAGCTCAGATGCAACAAACAAACAGTATGGGACCATTTGTTTCTGATTTTTTTATCAATGGTATCATTCTTAAATTCCTTGTACATTCTTTACTTCTCTCTGCATTATTATCAAATGATAAAGAGTTGTTTCAGTTGATTTTGGCTCCAGATTGGTATTGGGGGGAGAGTCAAACCGGATACATGTCTGCAAGCTTCTGTATTCAGATGGT...

Protein

Download Protein FASTA

174 aa · TkA04G273850|TK1151|PROTEIN

MHNIFLEYNDEIVHEWPAQMQQTNSMGPFVSDFFINGIILKFLVHSLLLSALLSNDKELFQLILAPDWYWGESQTGYMSASFCIQMVVAASVFTWIQVKPLQLTRLVHGRLVTKHLRHGLIFFLCDDTILSSKADGTGKRTGPSRAPIQIRETVGGGISLAGVTEAEVTSQEEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G273850`
TK1151 ID	TkA04G273850
OH-1004 ID	LXL04_037339
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G273850

Location Chr04:69180895-69182036 (+)

Description Similar to KIN4C: Kinesin-like protein KIN-4C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60930`	Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B9F2Y7`	Microtubule-dependent motor protein involved in the control of the oriented deposition of cellulose microfibrils.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0051231 spindle elongation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005875 microtubule associated complex Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0003777 microtubule motor activity Molecular Function

KEGG gene cross-reference

ath:AT5G60930

dosa:Os02g0742800

dosa:Os02g0742900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.310

Rank 1 · TkA04G273850 · TK1151

Cytoplasm0.261

Rank 2 · TkA04G273850 · TK1151

Nucleus0.210

Rank 3 · TkA04G273850 · TK1151

Endoplasmic reticulum0.113

Rank 4 · TkA04G273850 · TK1151

Cell membrane0.089

Rank 5 · TkA04G273850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01803LIM_bind6-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G273850	`PF01803`	LIM_bind	6	131	0.057	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K0J3`	Arabidopsis thaliana	sp\|F4K0J3\|KN4C_ARATH Kinesin-like protein KIN-4C	52.600%	Swiss-Prot	Low
`B9F2Y7`	Oryza sativa subsp. japonica	sp\|B9F2Y7\|KN4C_ORYSJ Kinesin-like protein KIN-4C	51.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card