TkA04G268580 | RubberDandelionOmics

Gene overview

TkA04G268580

Reference: TK1151 Chr: Chr04 Coordinates: 67872214-67872606 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA04G268580|TK1151|cDNA

ATGGCCACAGTCATCGCGGTCAACTTCACCATCACCACCAACGATCAAGAAACAACGTTCACTAACACGCCATACGTGAAACCATTTCCTAAAAGGGTAAGTCGTTTTCTAGCTGAAGAAAAGAACCCACGAGCTGCAGACCACTGCAATAAAAACGACGAGATTTGTTACATATTAGAAGGCAAAAACTCGACTTGTTGCAACAACAAATGCATGGATTTGAGCGAGGATAAACACAACTGTGGAGCATGCAAGAACAA...

CDS

Download CDS FASTA

393 bp · TkA04G268580|TK1151|CDS

ATGGCCACAGTCATCGCGGTCAACTTCACCATCACCACCAACGATCAAGAAACAACGTTCACTAACACGCCATACGTGAAACCATTTCCTAAAAGGGTAAGTCGTTTTCTAGCTGAAGAAAAGAACCCACGAGCTGCAGACCACTGCAATAAAAACGACGAGATTTGTTACATATTAGAAGGCAAAAACTCGACTTGTTGCAACAACAAATGCATGGATTTGAGCGAGGATAAACACAACTGTGGAGCATGCAAGAACAA...

Protein

Download Protein FASTA

130 aa · TkA04G268580|TK1151|PROTEIN

MATVIAVNFTITTNDQETTFTNTPYVKPFPKRVSRFLAEEKNPRAADHCNKNDEICYILEGKNSTCCNNKCMDLSEDKHNCGACKNKCKFTSSCCRGECVNLAYDKRHCGSCGNKCMPGGYCIYGLCNYA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G268580`
TK1151 ID	TkA04G268580
OH-1004 ID	LXL04_039793
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 90.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G268580

Location Chr04:67872214-67872606 (-)

Description Similar to At1g50720: Stigma-specific STIG1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26880`	Stigma-specific STIG1-like protein 1.	No verified direct reference in this release
`At5g55110`	Stigma-specific STIG1-like protein 2.	No verified direct reference in this release
`At1g50720`	Stigma-specific STIG1-like protein 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039793 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0048316 seed development Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G50650

ath:AT1G50720

ath:AT4G26880

ath:AT5G55110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.910

Rank 1 · TkA04G268580 · TK1151

Cytoplasm0.036

Rank 2 · TkA04G268580 · TK1151

Endoplasmic reticulum0.033

Rank 3 · TkA04G268580 · TK1151

Cell membrane0.028

Rank 4 · TkA04G268580 · TK1151

Lysosome / Vacuole0.014

Rank 5 · TkA04G268580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04885Stig147-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G268580	`PF04885`	Stig1	47	130	1.1e-28	100.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ28`	Arabidopsis thaliana	sp\|Q9SZ28\|STGL1_ARATH Stigma-specific STIG1-like protein 1	51.900%	Swiss-Prot	Medium
`Q9FLQ0`	Arabidopsis thaliana	sp\|Q9FLQ0\|STGL2_ARATH Stigma-specific STIG1-like protein 2	58.900%	Swiss-Prot	Low
`Q9C6T5`	Arabidopsis thaliana	sp\|Q9C6T5\|STGL3_ARATH Stigma-specific STIG1-like protein 3	60.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card