TkA04G260370 | RubberDandelionOmics

Gene overview

TkA04G260370

Reference: TK1151 Chr: Chr04 Coordinates: 65842915-65845142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1926 bp · TkA04G260370|TK1151|cDNA

ATGAAATGCTACAAAGCTAGGATGAGGGCTTTGTCTTTGATCAATGGCAAATTGAGTGATCACTATGCAAGAGTATGGGAATATAGGCAAGAGTTACTTAGAGCTAATCCTGGAAGTACAATTAGGATATCTGTGGTAGAAAATCCAGATGGGACCACAGTTTTCCATAGGATGTACATATGTTTTAAAGCAATTAGGGAGGGATGGAAGAAGGGATGTCGTAGGGCTTATCTTGGATTGCATACTGGAGTTGGATTGTG...

CDS

Download CDS FASTA

1926 bp · TkA04G260370|TK1151|CDS

ATGAAATGCTACAAAGCTAGGATGAGGGCTTTGTCTTTGATCAATGGCAAATTGAGTGATCACTATGCAAGAGTATGGGAATATAGGCAAGAGTTACTTAGAGCTAATCCTGGAAGTACAATTAGGATATCTGTGGTAGAAAATCCAGATGGGACCACAGTTTTCCATAGGATGTACATATGTTTTAAAGCAATTAGGGAGGGATGGAAGAAGGGATGTCGTAGGGCTTATCTTGGATTGCATACTGGAGTTGGATTGTG...

Protein

Download Protein FASTA

641 aa · TkA04G260370|TK1151|PROTEIN

MKCYKARMRALSLINGKLSDHYARVWEYRQELLRANPGSTIRISVVENPDGTTVFHRMYICFKAIREGWKKGCRRAYLGLHTGVGLCLISDQHKGLVEGVKEILPRAEHRQCARHIYANFRKVYSGVEYRKLFWAASKSTTEGDFKYYMESIKTLSSDAYDILMGGQPSTWCRAYFSTGLACEAVENGMVECFNSLITDARKKPLLTMMEEIRLYMMERFFNLKHEALKWENDVCPAAISKMENRAKDSRNWQVIHSGVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G260370`
TK1151 ID	TkA04G260370
OH-1004 ID	LXL04_037214
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	90.200
Protein coverage (%)	TK1151 100.000 / OH-1004 34.539 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G260370`
Location	Chr04:65842915-65845142 (-)
Description	Similar to At1g65750: Putative ribonuclease H protein At1g65750
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037214` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003676 nucleic acid binding Molecular Function GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · TkA04G260370 · TK1151

Cytoplasm0.132

Rank 2 · TkA04G260370 · TK1151

Mitochondrion0.020

Rank 3 · TkA04G260370 · TK1151

Cell membrane0.019

Rank 4 · TkA04G260370 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA04G260370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10551MULE10-39 aa

PF10551MULE86-119 aa

PF00872Transposase_mut88-122 aa

PF14566PTPlike_phytase96-158 aa

PF10790DUF2604233-274 aa

PF04434SWIM280-295 aa

PF13696zf-CCHC_2383-396 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G260370	`PF10551`	MULE	10	39	0.0001	23.3
TkA04G260370	`PF10551`	MULE	86	119	0.0001	23.3
TkA04G260370	`PF00872`	Transposase_mut	88	122	0.00017	21.3
TkA04G260370	`PF14566`	PTPlike_phytase	96	158	0.13	13.1
TkA04G260370	`PF10790`	DUF2604	233	274	0.076	14.1
TkA04G260370	`PF04434`	SWIM	280	295	0.0029	17.8
TkA04G260370	`PF13696`	zf-CCHC_2	383	396	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card