TkA04G231360 | RubberDandelionOmics

Gene overview

TkA04G231360

Reference: TK1151 Chr: Chr04 Coordinates: 58754546-58755900 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA04G231360|TK1151|cDNA

TTCTCAAGTACCAACAGTCACAAAAAAAATAAAACTCAACCACATGCATTGCCAGGTCATGGAGAAAACAGCAGCGAGGCCATCCGAAAAGATCTGGAAAAACATCAAGGATTTGCAGCTGGATCAACTGATGGACGTGTAGCATTAAAGTATTTTAATCCATCTAGCCAAAACACTAATGGGAATTTTGGCGACTTTGTCCCCGATGATAATAAGGGTTATGTCACCATATGGAATGCTCAAAGTAAAAGGAGAGTTAA...

CDS

Download CDS FASTA

384 bp · TkA04G231360|TK1151|CDS

TTCTCAAGTACCAACAGTCACAAAAAAAATAAAACTCAACCACATGCATTGCCAGGTCATGGAGAAAACAGCAGCGAGGCCATCCGAAAAGATCTGGAAAAACATCAAGGATTTGCAGCTGGATCAACTGATGGACGTGTAGCATTAAAGTATTTTAATCCATCTAGCCAAAACACTAATGGGAATTTTGGCGACTTTGTCCCCGATGATAATAAGGGTTATGTCACCATATGGAATGCTCAAAGTAAAAGGAGAGTTAA...

Protein

Download Protein FASTA

127 aa · TkA04G231360|TK1151|PROTEIN

FSSTNSHKKNKTQPHALPGHGENSSEAIRKDLEKHQGFAAGSTDGRVALKYFNPSSQNTNGNFGDFVPDDNKGYVTIWNAQSKRRVNEMPKFENSIASLSYKLQPWRRVSGCCFKLHLASTEKKMNC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G231360`
TK1151 ID	TkA04G231360
OH-1004 ID	LXL04_005757
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.500
Protein coverage (%)	TK1151 93.701 / OH-1004 37.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G231360

Location Chr04:58754546-58755900 (-)

Description Similar to CKL4: Casein kinase 1-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69400`	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005757 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G72710

ath:AT4G26100

ath:AT4G28860

ath:AT4G28880

ath:AT5G57015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.604

Rank 1 · TkA04G231360 · TK1151

Cytoplasm0.323

Rank 2 · TkA04G231360 · TK1151

Mitochondrion0.067

Rank 3 · TkA04G231360 · TK1151

Cell membrane0.058

Rank 4 · TkA04G231360 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA04G231360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I241`	Arabidopsis thaliana	sp\|F4I241\|BUB33_ARATH Mitotic checkpoint protein BUB3.3	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card