TkA04G225230 | RubberDandelionOmics

Gene overview

TkA04G225230

Reference: TK1151 Chr: Chr04 Coordinates: 57286823-57295607 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2091 bp · TkA04G225230|TK1151|cDNA

GCAAATTCCTCTATTGACAGCATGGAGGACCCAAACCCGTCTTTCGTCCATTCAACAAAGCTTTCTTTTCATTTTCTGGTTTCACAACGTTCTTGGAAAAAGGTTACACGCTTTTGAGAAAGCATCATTTTTCAGCAAGGTGCAAATTATTTGAAATTGATTCTTCCTTAATTTGCGAGCATTTCATTTCTATCATAGAGATAATATATGAGGGAATGAGATATGAGTTGTTGCTTCGGAAGCAAGGACCCAGAAATTAT...

CDS

Download CDS FASTA

1746 bp · TkA04G225230|TK1151|CDS

ATGAGTTGTTGCTTCGGAAGCAAGGACCCAGAAATTATTGAAAAATACGATTCGCCTGTGGCACAACCAAAAGGAAACCCAACTTTTATCCCTCCTGGTCCTGTGACGTCAGGACCTTTTAGTCAAGTCGATAATAGAAAACAAGAAGGTTGTGGTCCCTCTGCTCCAACTACTGCTCCTGCTACCATCAATACAAATGAAGGCAATGAAGTTAATTATAATTCAGCCCGTAATTTTGGTTTTCGGGAGGTCGCAATAGC...

Protein

Download Protein FASTA

581 aa · TkA04G225230|TK1151|PROTEIN

MSCCFGSKDPEIIEKYDSPVAQPKGNPTFIPPGPVTSGPFSQVDNRKQEGCGPSAPTTAPATINTNEGNEVNYNSARNFGFREVAIATKNFRRECLLGESAFGKVYKGTLQGTGQVVAVKQLDRHGTKANKEFLVEVMKLSRLQHPNLVQLIGYCVDGDQRILVYEFMQSGCLRDHLHEIPLERTPLNWTTRMKIASESAQALEYLHEKANPPILYRNFKSSNIMLDENFNPKLLDYGLIKLQIDSGNTMHQRIVGTIGC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G225230`
TK1151 ID	TkA04G225230
OH-1004 ID	LXL04_015002
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.100
Protein coverage (%)	TK1151 49.914 / OH-1004 40.056 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G225230

Location Chr04:57286823-57295607 (-)

Description Similar to PBL26: Probable serine/threonine-protein kinase PBL26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13190`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g07070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g02810`	Involved in pollen tube guidance into micropyle.	No verified direct reference in this release
`At5g13160`	Protein kinase required for plant defense mechanism mediated by the disease resistance (R) protein RPS5.	The Arabidopsis PBS1 resistance gene encodes a member of a novel protein kinase subfamily.2001 · DOI: 10.1046/j.1365-313x.2001.01014.x Cleavage of Arabidopsis PBS1 by a bacterial type III effector.2003 · DOI: 10.1126/science.1085671 Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease.2007 · DOI: 10.1073/pnas.0608779104 Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 Activation of a plant nucleotide binding-leucine rich repeat disease resistance protein by a modified self protein.2012 · DOI: 10.1111/j.1462-5822.2012.01779.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0372100`	Functions as an immediate downstream signaling partner of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015002 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G02810

ath:AT3G07070

ath:AT4G13190

ath:AT5G02800

ath:AT5G16500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.640

Rank 1 · TkA04G225230 · TK1151

Cytoplasm0.254

Rank 2 · TkA04G225230 · TK1151

Nucleus0.228

Rank 3 · TkA04G225230 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA04G225230 · TK1151

Golgi apparatus0.032

Rank 5 · TkA04G225230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase94-359 aa

PF07714PK_Tyr_Ser-Thr95-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G225230	`PF00069`	Pkinase	94	359	5.3e-38	131.6
TkA04G225230	`PF07714`	PK_Tyr_Ser-Thr	95	362	3.3e-40	138.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PE89`	Arabidopsis thaliana	sp\|Q1PE89\|PBL24_ARATH Probable serine/threonine-protein kinase PBL24	56.600%	Swiss-Prot	Medium
`Q9SFT7`	Arabidopsis thaliana	sp\|Q9SFT7\|PBL26_ARATH Probable serine/threonine-protein kinase PBL26	58.900%	Swiss-Prot	Medium
`Q9M8S2`	Arabidopsis thaliana	sp\|Q9M8S2\|LIPG2_ARATH Receptor-like kinase LIP2	63.800%	Swiss-Prot	Medium
`Q9FE20`	Arabidopsis thaliana	sp\|Q9FE20\|PBS1_ARATH Serine/threonine-protein kinase PBS1	61.400%	Swiss-Prot	Medium
`Q6I5Q6`	Oryza sativa subsp. japonica	sp\|Q6I5Q6\|RK185_ORYSJ Receptor-like cytoplasmic kinase 185	62.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card