TkA04G225170 | RubberDandelionOmics

Gene overview

TkA04G225170

Reference: TK1151 Chr: Chr04 Coordinates: 57263986-57267840 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2903 bp · TkA04G225170|TK1151|cDNA

TAATTCTCCGTCTTGTGAAACTTGTAAACTTCAAATAGAGTCGTCAACAAATACACGCACGCAGCCACGTTTTCTCCTCCCCTATAACTATTACACCCACTTTTTCTTCTCTAATTTCAGGCACAACGAAAACGACCCTTTCAACAATTTCACACATTCTTTTCAGTTTTACCAATTTCATATTCAAAATCAGATACAAAATTCTCTCGTTGGCGCCGGCAAATTGATTGCCTATTTTTTCCTGTCACCTTTTCTGTAAA...

CDS

Download CDS FASTA

2259 bp · TkA04G225170|TK1151|CDS

ATGGTATCGACCCAAAGCGTGGGTGTTGCATTCGGACCTACCGAGAAAACCCACCGCCATGGGTGGTGGCGCGTGAACGACAATGGCGGCGTTCCATCTACTCTGTCTTTTCTGTTTGTATCGTTTATGGTGTTTAGTTCAATTGGGTTTTTGTATACGTATATGATGTACAAGAGCCCTAATTCAGTCGGTTGTGAAGAGGACAGTGAGGGTTCATGGTCAATTGGAGTTTTCTATGGCGATTCTCCGTTTTCGCTTAA...

Protein

Download Protein FASTA

752 aa · TkA04G225170|TK1151|PROTEIN

MVSTQSVGVAFGPTEKTHRHGWWRVNDNGGVPSTLSFLFVSFMVFSSIGFLYTYMMYKSPNSVGCEEDSEGSWSIGVFYGDSPFSLKPIEAMNVWENTSAAWPVANPIVTCGSVTDSGFPSNFVADPFLYVQGDVVYLFFETKNPITMQGDIGVAKSVDNGASWEQLGVVLDEEWHLSYPYVFDYNGQIYMMPEGSKKGDLRVYRAVNFPVKWELEKIILKRPLIDSFIIKYESRYYLFGSDHTRVTAKKNGELEIWYGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G225170`
TK1151 ID	TkA04G225170
OH-1004 ID	LXL04_024503
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G225170

Location Chr04:57263986-57267840 (+)

Description Similar to GINT1: Glucosamine inositolphosphorylceramide transferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04500`	Glycosyltransferase that mediates the glycosylation of glycosylinositol phosphorylceramides (GIPCs), the major sphingolipids in the plasma membrane.	GLUCOSAMINE INOSITOLPHOSPHORYLCERAMIDE TRANSFERASE1 (GINT1) Is a GlcNAc-Containing Glycosylinositol Phosphorylceramide Glycosyltransferase.2018 · DOI: 10.1104/pp.18.00396

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0540000`	Essential protein.	GLUCOSAMINE INOSITOLPHOSPHORYLCERAMIDE TRANSFERASE1 (GINT1) Is a GlcNAc-Containing Glycosylinositol Phosphorylceramide Glycosyltransferase.2018 · DOI: 10.1104/pp.18.00396
`UniProt: A2Y6Z7`	Essential protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024503 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006044 N-acetylglucosamine metabolic process Biological Process

GO:0006688 glycosphingolipid biosynthetic process Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009845 seed germination Biological Process

GO:0015012 heparan sulfate proteoglycan biosynthetic process Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030210 heparin proteoglycan biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT5G04500

dme:Dmel_CG15110

dme:Dmel_CG8433

dosa:Os05g0540000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.638

Rank 1 · TkA04G225170 · TK1151

Endoplasmic reticulum0.237

Rank 2 · TkA04G225170 · TK1151

Cytoplasm0.094

Rank 3 · TkA04G225170 · TK1151

Cell membrane0.062

Rank 4 · TkA04G225170 · TK1151

Lysosome / Vacuole0.054

Rank 5 · TkA04G225170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24793GINT1_N65-368 aa

PF04616Glyco_hydro_43227-282 aa

PF16396DUF5005228-297 aa

PF09258Glyco_transf_64502-736 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G225170	`PF24793`	GINT1_N	65	368	1.8e-171	569.8
TkA04G225170	`PF04616`	Glyco_hydro_43	227	282	0.0054	16.8
TkA04G225170	`PF16396`	DUF5005	228	297	0.1	13.1
TkA04G225170	`PF09258`	Glyco_transf_64	502	736	4.9e-62	210.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WB7`	Arabidopsis thaliana	sp\|Q84WB7\|GINT1_ARATH Glucosamine inositolphosphorylceramide transferase 1	59.400%	Swiss-Prot	High
`Q53WK1`	Oryza sativa subsp. japonica	sp\|Q53WK1\|GINT1_ORYSJ Glucosamine inositolphosphorylceramide transferase 1	54.600%	Swiss-Prot	High
`A2Y6Z7`	Oryza sativa subsp. indica	sp\|A2Y6Z7\|GINT1_ORYSI Glucosamine inositolphosphorylceramide transferase 1	54.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card