TkA04G208470 | RubberDandelionOmics

Gene overview

TkA04G208470

Reference: TK1151 Chr: Chr04 Coordinates: 53420890-53425488 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2022 bp · TkA04G208470|TK1151|cDNA

ATGTTCAATCATATTCTTGGAGAGTCTCTTGAAACCCAGCTCCAAAGGTTCACCACTCTCACCACTGAGATAAGCACTGCTGGTATTGTGCTTCCTAAATCAGAGATCAACAAGAAGTTGTTAAACTCTCTTCACGAGAAGTGGGACATGAACGTGTTTGTGATGAAAAAGACCAGCGACCTAAACACCATGACTCTCGCTGAAACCTTAGCTGTCACCAAATCCTTTGATATGGACGTCAAGCGGCGTGAGATAAATCG...

CDS

Download CDS FASTA

2022 bp · TkA04G208470|TK1151|CDS

ATGTTCAATCATATTCTTGGAGAGTCTCTTGAAACCCAGCTCCAAAGGTTCACCACTCTCACCACTGAGATAAGCACTGCTGGTATTGTGCTTCCTAAATCAGAGATCAACAAGAAGTTGTTAAACTCTCTTCACGAGAAGTGGGACATGAACGTGTTTGTGATGAAAAAGACCAGCGACCTAAACACCATGACTCTCGCTGAAACCTTAGCTGTCACCAAATCCTTTGATATGGACGTCAAGCGGCGTGAGATAAATCG...

Protein

Download Protein FASTA

673 aa · TkA04G208470|TK1151|PROTEIN

MFNHILGESLETQLQRFTTLTTEISTAGIVLPKSEINKKLLNSLHEKWDMNVFVMKKTSDLNTMTLAETLAVTKSFDMDVKRREINRAGYNNGASSNSAFAAQPSMVAPPQPSYIPNVQQPSIYSTGSSSTVPASHTAQMVKGIKENLGEMAGNCYNAVVNGELPATVMMSELDQIHPDDVEEMDISWHIGMAVFHAKKFTQRTGRNIWGRWSNNDRALVAHQFDWEDQLQALNLGDHHTADQAQIEETEEIEDQVMELQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G208470`
TK1151 ID	TkA04G208470
OH-1004 ID	LXL04_008100
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.400
Protein coverage (%)	TK1151 99.257 / OH-1004 37.403 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G208470`
Location	Chr04:53420890-53425488 (-)
Description	Similar to GIP: Copia protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008100` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · TkA04G208470 · TK1151

Nucleus0.384

Rank 2 · TkA04G208470 · TK1151

Mitochondrion0.062

Rank 3 · TkA04G208470 · TK1151

Cell membrane0.059

Rank 4 · TkA04G208470 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA04G208470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223Retrotran_gag_27-68 aa

PF00098zf-CCHC154-157 aa

PF08707PriCT_2173-216 aa

PF16809NleF_casp_inhib242-304 aa

PF08581Tup_N243-281 aa

PF08581Tup_N269-314 aa

PF30379SLU7_N493-510 aa

PF00098zf-CCHC496-512 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G208470	`PF14223`	Retrotran_gag_2	7	68	0.00042	20.8
TkA04G208470	`PF00098`	zf-CCHC	154	157	0.0061	17.3
TkA04G208470	`PF08707`	PriCT_2	173	216	0.034	15.3
TkA04G208470	`PF16809`	NleF_casp_inhib	242	304	0.59	10.9
TkA04G208470	`PF08581`	Tup_N	243	281	1.8	9.6
TkA04G208470	`PF08581`	Tup_N	269	314	1.8	9.6
TkA04G208470	`PF30379`	SLU7_N	493	510	0.0073	16.5
TkA04G208470	`PF00098`	zf-CCHC	496	512	0.0061	17.3
TkA04G208470	`PF16809`	NleF_casp_inhib	552	563	0.59	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card