TkA04G202200 | RubberDandelionOmics

Gene overview

TkA04G202200

Reference: TK1151 Chr: Chr04 Coordinates: 51989650-51992656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1306 bp · TkA04G202200|TK1151|cDNA

AATTCAACTTGATGAGAAGTTGGCCCCTTGATTCATACTCAACTCCATTTGACTCTAAGATCTACTCCTCCGCACCAAATTTCCCGATCCCCGACCACCAGAAAAGCAATCGACACAGCATCATCTGATGCAATAGTTTTATACTTGGATTACCTAAGTCCAACATTGATTTGAGCCCTAAACTGAATCAGCTATAACTCACAATCCGGTACTCATGAGTTCTCCGGCAGTTGCGAACTTGTTTACGGGATTTACGAGGC...

CDS

Download CDS FASTA

996 bp · TkA04G202200|TK1151|CDS

ATGACTACGTTGAAGTATTTGCCAAAACATCACGAATTTGCTCTTGTTATTTTGTTGTTTGACGAATGGTGGCAGGTTGCGAACTTGTTTACGGGATTTACGAGGCTGTGTAAAGGGCTCGCGGCAGTACTTGTTTGTGGATACATTGCTGTTCAGATCTTCCCTTCTATCCTTACTTACGTTGCACTCATACCTGGCAGGACCATTCCTTTTGGCTGGAACCTCTTAACAGCTGGTTATGTAGAACAAACAGTATACGG...

Protein

Download Protein FASTA

331 aa · TkA04G202200|TK1151|PROTEIN

MTTLKYLPKHHEFALVILLFDEWWQVANLFTGFTRLCKGLAAVLVCGYIAVQIFPSILTYVALIPGRTIPFGWNLLTAGYVEQTVYGVVSSTIGLVLIGKVLEPIWGSREFLKFIFIVNFLTSVCVFITTISLYYVTMQESYLYTPLSGFSGVLAGLLVGIKQIIPDQEFSPLKIKVKWLPSMMVLLGICVSFFTMEAAASYLPVLIFGTYTGWIYLRYFQRKQETGFKGDPSPEFAFSTFFPEFLRAVIDPMATVFDRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G202200`
TK1151 ID	TkA04G202200
OH-1004 ID	LXL04_034828
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 92.447 / OH-1004 98.392 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G202200

Location Chr04:51989650-51992656 (+)

Description Similar to RBL19: Rhomboid-like protein 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07950`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034828 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0015031 protein transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0017119 Golgi transport complex Cellular Component

GO:0030137 COPI-coated vesicle Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G07950

bta:532459

hsa:11070

mmu:56395

sce:YOL107W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.450

Rank 1 · TkA04G202200 · TK1151

Golgi apparatus0.357

Rank 2 · TkA04G202200 · TK1151

Cytoplasm0.173

Rank 3 · TkA04G202200 · TK1151

Cell membrane0.115

Rank 4 · TkA04G202200 · TK1151

Nucleus0.098

Rank 5 · TkA04G202200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08551DUF175139-308 aa

PF01694Rhomboid42-42 aa

PF01694Rhomboid73-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G202200	`PF08551`	DUF1751	39	308	6.7e-71	239.6
TkA04G202200	`PF01694`	Rhomboid	42	42	0.00059	20.8
TkA04G202200	`PF01694`	Rhomboid	73	218	0.00059	20.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LF05`	Arabidopsis thaliana	sp\|Q8LF05\|RBL19_ARATH Rhomboid-like protein 19	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card