TkA04G199430 | RubberDandelionOmics

Gene overview

TkA04G199430

Reference: TK1151 Chr: Chr04 Coordinates: 51333312-51337897 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1892 bp · TkA04G199430|TK1151|cDNA

GATAGATTAGGGGAAGTATGTCTAATACATTCTAAGCTATGAGGGGCACACTCAATTCTAAATAATTTTCTTCGAAAACAAACACCAGATACACTTCACATCCATTCTTTCTTGTTTGCCTCACCGAATCATCAGACCGCTCTCCGATTTTTAGGTTTTCTCAACACCTTAGAGCTCCGCTTTCCTTGCCCACCTCTCCCTTTTTACGTTTTCTTTTTGGGTGTTACTTAACAGCCAATTTCACACGACGCTACTCCACC...

CDS

Download CDS FASTA

1188 bp · TkA04G199430|TK1151|CDS

ATGGAGTCATTATGGAAGCTCGTTTTCCTCATGGAACCAGCGCCAGTGACTCTCATCCTAACAGCCATTGCCGTGACTCTAGGATCTGCAGTCCGAGCTCTAAACTACACCAAACAAATGGAAAAAAACCGCGACCTCTCAGAAGCATCAATCACACTCGACAAATCTCAAGCACTCATGATTCCAATAATGAGCTCATTCAGTCTCCTAACAATGTTCTACTTATTCTCATCAGTCTCACAACTCCTCACAGCTTTCAC...

Protein

Download Protein FASTA

395 aa · TkA04G199430|TK1151|PROTEIN

MESLWKLVFLMEPAPVTLILTAIAVTLGSAVRALNYTKQMEKNRDLSEASITLDKSQALMIPIMSSFSLLTMFYLFSSVSQLLTAFTAIAAISSLYFLFSPFISHPKSQFNSKSLTRIQSLLLFLCISTVTAWLVSGHWILNNMLGISLCVAFVSHVRLPNIKVCTMLLICLFVYDIFWVFYSEWFFGANVMVAVATQQASNPVHTVANSLSLPGLQLITKKLELPVKIVFPRNLFGGVVPGNTATDFMMLGLGDMAIPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G199430`
TK1151 ID	TkA04G199430
OH-1004 ID	LXL04_034823
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 90.633 / OH-1004 99.721 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G199430

Location Chr04:51333312-51337897 (+)

Description Similar to SPPL1: Signal peptide peptidase-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33410`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0393100`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034823 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007204 positive regulation of cytosolic calcium ion concentration Biological Process

GO:0016485 protein processing Biological Process

GO:0033619 membrane protein proteolysis Biological Process

GO:0050852 T cell receptor signaling pathway Biological Process

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005791 rough endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G33410

dme:Dmel_CG17370

dosa:Os10g0393100

hsa:121665

mmu:74585

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.590

Rank 1 · TkA04G199430 · TK1151

Golgi apparatus0.215

Rank 2 · TkA04G199430 · TK1151

Nucleus0.127

Rank 3 · TkA04G199430 · TK1151

Cell membrane0.089

Rank 4 · TkA04G199430 · TK1151

Cytoplasm0.087

Rank 5 · TkA04G199430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13493DUF411819-30 aa

PF04258Peptidase_A22B49-345 aa

PF03208PRA168-162 aa

PF13493DUF411870-136 aa

PF03208PRA1167-218 aa

PF13493DUF4118298-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G199430	`PF13493`	DUF4118	19	30	2.9	8.4
TkA04G199430	`PF04258`	Peptidase_A22B	49	345	1.6e-73	248.5
TkA04G199430	`PF03208`	PRA1	68	162	2.8	8.3
TkA04G199430	`PF13493`	DUF4118	70	136	2.9	8.4
TkA04G199430	`PF03208`	PRA1	167	218	2.8	8.3
TkA04G199430	`PF13493`	DUF4118	298	323	2.9	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z32`	Arabidopsis thaliana	sp\|Q93Z32\|SIPL1_ARATH Signal peptide peptidase-like 1	71.800%	Swiss-Prot	High
`Q7G7C7`	Oryza sativa subsp. japonica	sp\|Q7G7C7\|SIPL1_ORYSJ Signal peptide peptidase-like 1	66.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card