TkA04G195610 | RubberDandelionOmics

Gene overview

TkA04G195610

Reference: TK1151 Chr: Chr04 Coordinates: 50393352-50393792 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA04G195610|TK1151|cDNA

ATGGCATGGGGACTAGCTAAGAGTAATCAGCCCTTTTTATGGGTGGTTCGACCCGGTTTGGTTCATGGTGTGACTGGATCGAGTTTTTGCCGGATGATTTGGCGAGGAGATGAAGGTGAGAGGTTGATTGTGAAATGGGCACCGCAGAATAAGATTTTGGCACATTTTGCAATTGGAGGATTTTGGAGCCATTGTGGTTGGAATTCGACCTTGGAGAGTGTATCTGCTGGGGTTCCGATGTTGTGTCAACCTTTAAGTAT...

CDS

Download CDS FASTA

441 bp · TkA04G195610|TK1151|CDS

ATGGCATGGGGACTAGCTAAGAGTAATCAGCCCTTTTTATGGGTGGTTCGACCCGGTTTGGTTCATGGTGTGACTGGATCGAGTTTTTGCCGGATGATTTGGCGAGGAGATGAAGGTGAGAGGTTGATTGTGAAATGGGCACCGCAGAATAAGATTTTGGCACATTTTGCAATTGGAGGATTTTGGAGCCATTGTGGTTGGAATTCGACCTTGGAGAGTGTATCTGCTGGGGTTCCGATGTTGTGTCAACCTTTAAGTAT...

Protein

Download Protein FASTA

146 aa · TkA04G195610|TK1151|PROTEIN

MAWGLAKSNQPFLWVVRPGLVHGVTGSSFCRMIWRGDEGERLIVKWAPQNKILAHFAIGGFWSHCGWNSTLESVSAGVPMLCQPLSIDQMSNASVEDGFGNRCGGGEIESAIRKILAMKEGEEMRRRAVEIEEQVRAAVSSHGGSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G195610`
TK1151 ID	TkA04G195610
OH-1004 ID	LXL04_000553
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.300
Protein coverage (%)	TK1151 98.630 / OH-1004 29.741 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G195610

Location Chr04:50393352-50393792 (-)

Description Similar to UGT76H1: UDP-glycosyltransferase 76H1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46670`	Possesses low quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At5g59580`	Possesses low quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At3g46660`	Possesses quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At3g46700`	UDP-glycosyltransferase 76E3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000553 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1900994 (-)-secologanin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010294 abscisic acid glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G46670

ath:AT5G59590

sly:101246393

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.375

Rank 1 · TkA04G195610 · TK1151

Cytoplasm0.344

Rank 2 · TkA04G195610 · TK1151

Nucleus0.103

Rank 3 · TkA04G195610 · TK1151

Mitochondrion0.079

Rank 4 · TkA04G195610 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkA04G195610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT1-94 aa

PF06722EryCIII-like_C44-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G195610	`PF00201`	UDPGT	1	94	3.4e-17	63.2
TkA04G195610	`PF06722`	EryCIII-like_C	44	106	0.16	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SNB1`	Arabidopsis thaliana	sp\|Q9SNB1\|U7E11_ARATH UDP-glycosyltransferase 76E11	48.100%	Swiss-Prot	Medium
`Q9LTH3`	Arabidopsis thaliana	sp\|Q9LTH3\|U76E1_ARATH UDP-glycosyltransferase 76E1	45.900%	Swiss-Prot	Medium
`Q94AB5`	Arabidopsis thaliana	sp\|Q94AB5\|U7E12_ARATH Flavonol 3-O-glucosyltransferase UGT76E12	48.400%	Swiss-Prot	Medium
`Q494Q1`	Arabidopsis thaliana	sp\|Q494Q1\|U76E3_ARATH UDP-glycosyltransferase 76E3	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card