TkA04G194140 | RubberDandelionOmics

Gene overview

TkA04G194140

Reference: TK1151 Chr: Chr04 Coordinates: 50059351-50061270 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1426 bp · TkA04G194140|TK1151|cDNA

TCCATCAACGATCTTCATCTTCTCAAGCTCCAAAATCTCTCTGCAGCAACAGGGGTTATCCTTGTCAAGGATCGAATCTTTTTGGTTGCTGCAGTAGATTTGAGGAGAAATGGGAAAGAAGAGTTGGTTTTCCGCTGTAACGAAAGTTATATCCACTTCTTATCTCAAAGAGAAGAAACTCAAGGTTTGTATCTCTTTCTTTCAGTTTTAATATGTTTCGCTAATGGCAATAACAAATTCTCATCGCGACAGAAATCCCA...

CDS

Download CDS FASTA

1131 bp · TkA04G194140|TK1151|CDS

TCCATCAACGATCTTCATCTTCTCAAGCTCCAAAATCTCTCTGCAGCAACAGGGGTTATCCTTGTCAAGGATCGAATCTTTTTGGTTGCTGCAGTAGATTTGAGGAGAAATGGGAAAGAAGAGTTGGTTTTCCGCTGTAACGAAAGTTATATCCACTTCTTATCTCAAAGAGAAGAAACTCAAGGTTTGTATCTCTTTCTTTCAGTTTTAATATGTTTCGCTAATGGCAATAACAAATTCTCATCGCGACAGAAATCCCA...

Protein

Download Protein FASTA

376 aa · TkA04G194140|TK1151|PROTEIN

SINDLHLLKLQNLSAATGVILVKDRIFLVAAVDLRRNGKEELVFRCNESYIHFLSQREETQGLYLFLSVLICFANGNNKFSSRQKSHNKSKSTKKACHGNRMSLDKSLSPTKSILPIPKDEPKPEFKYEPMEQDSNPIAIQNTTSPADAEVNCVQSREDMAAIKIQKVYRGYMVRKGSNPLKAWRKLKMYMISHAVKRQGVSSLMSVQTMARVQSEVRTRKIRMAQVNEQLHQKRLNKLNIAKCSERSGWDLSPKSKEQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G194140`
TK1151 ID	TkA04G194140
OH-1004 ID	LXL04_034971
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 77.926 / OH-1004 92.405 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G194140

Location Chr04:50059351-50061270 (-)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09710`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins.	Arabidopsis IQD1, a novel calmodulin-binding nuclear protein, stimulates glucosinolate accumulation and plant defense.2005 · DOI: 10.1111/j.1365-313x.2005.02435.x Arabidopsis calmodulin-binding protein IQ67-domain 1 localizes to microtubules and interacts with kinesin light chain-related protein-1.2013 · DOI: 10.1074/jbc.m112.396200
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g52290`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g59690`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034971 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0051592 response to calcium ion Biological Process

GO:2000652 regulation of secondary cell wall biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G26410

ath:AT3G09710

ath:AT3G52290

ath:AT3G59690

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.450

Rank 1 · TkA04G194140 · TK1151

Nucleus0.350

Rank 2 · TkA04G194140 · TK1151

Cell membrane0.297

Rank 3 · TkA04G194140 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA04G194140 · TK1151

Golgi apparatus0.037

Rank 5 · TkA04G194140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15411PH_1058-96 aa

PF16287DUF493369-114 aa

PF24609IQ_SCN5A_C157-177 aa

PF00612IQ160-176 aa

PF24609IQ_SCN5A_C182-189 aa

PF16287DUF4933257-301 aa

PF15411PH_10274-293 aa

PF00612IQ286-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G194140	`PF15411`	PH_10	58	96	0.25	12.3
TkA04G194140	`PF16287`	DUF4933	69	114	0.11	12.3
TkA04G194140	`PF24609`	IQ_SCN5A_C	157	177	0.04	14.1
TkA04G194140	`PF00612`	IQ	160	176	8.9e-06	25.8
TkA04G194140	`PF24609`	IQ_SCN5A_C	182	189	0.04	14.1
TkA04G194140	`PF16287`	DUF4933	257	301	0.11	12.3
TkA04G194140	`PF15411`	PH_10	274	293	0.25	12.3
TkA04G194140	`PF00612`	IQ	286	295	8.9e-06	25.8
TkA04G194140	`PF24609`	IQ_SCN5A_C	286	297	0.04	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF32`	Arabidopsis thaliana	sp\|Q9SF32\|IQD1_ARATH Protein IQ-DOMAIN 1	34.100%	Swiss-Prot	Low
`Q93ZH7`	Arabidopsis thaliana	sp\|Q93ZH7\|IQD2_ARATH Protein IQ-DOMAIN 2	32.300%	Swiss-Prot	Medium
`Q9FT53`	Arabidopsis thaliana	sp\|Q9FT53\|IQD3_ARATH Protein IQ-DOMAIN 3	34.200%	Swiss-Prot	Low
`Q9M199`	Arabidopsis thaliana	sp\|Q9M199\|IQD13_ARATH Protein IQ-DOMAIN 13	35.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card