TkA04G191360 | RubberDandelionOmics

Gene overview

TkA04G191360

Reference: TK1151 Chr: Chr04 Coordinates: 49385365-49387789 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA04G191360|TK1151|cDNA

ATGGTACGAAACATTGGTAAAGAATGGGATTTACTGAAGGTGAAGAATGACAAAAGGGAAATCGAAGATGAATATGAAAGTGAGTATGAAAAGAAGCTAAACGAGTATTTCCAGGAGGACGAAAAGTTAGATGAAAACGAGAAGTTTCTGAAGGATTATATCAGGAAAAAGATGTGGTTAGATAACGAAAGTGGTAATACGCGTTCAAACAACATCGAATTAGATGTTTCAGAGGATGAAGAAGAGTTAGAAAGGCAAGA...

CDS

Download CDS FASTA

432 bp · TkA04G191360|TK1151|CDS

ATGGTACGAAACATTGGTAAAGAATGGGATTTACTGAAGGTGAAGAATGACAAAAGGGAAATCGAAGATGAATATGAAAGTGAGTATGAAAAGAAGCTAAACGAGTATTTCCAGGAGGACGAAAAGTTAGATGAAAACGAGAAGTTTCTGAAGGATTATATCAGGAAAAAGATGTGGTTAGATAACGAAAGTGGTAATACGCGTTCAAACAACATCGAATTAGATGTTTCAGAGGATGAAGAAGAGTTAGAAAGGCAAGA...

Protein

Download Protein FASTA

143 aa · TkA04G191360|TK1151|PROTEIN

MVRNIGKEWDLLKVKNDKREIEDEYESEYEKKLNEYFQEDEKLDENEKFLKDYIRKKMWLDNESGNTRSNNIELDVSEDEEELERQEEYEREFNFRFEENAGDRVMGFSRKVDGLVRKKDNARKIQRKNKEERIAQADFERKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G191360`
TK1151 ID	TkA04G191360
OH-1004 ID	LXL04_011296
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.100
Protein coverage (%)	TK1151 95.105 / OH-1004 21.485 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G191360`
Location	Chr04:49385365-49387789 (-)
Description	Similar to KRI1: Protein KRI1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011296` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0030686 90S preribosome Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	bta:511427 dre:402800 hsa:65095 spo:2541654 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkA04G191360 · TK1151

Cytoplasm0.166

Rank 2 · TkA04G191360 · TK1151

Mitochondrion0.017

Rank 3 · TkA04G191360 · TK1151

Cell membrane0.010

Rank 4 · TkA04G191360 · TK1151

Extracellular0.006

Rank 5 · TkA04G191360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10224DUF220514-29 aa

PF21265SBB_T715-68 aa

PF10224DUF220538-58 aa

PF24938DUF775556-100 aa

PF10224DUF220575-86 aa

PF21265SBB_T797-125 aa

PF10224DUF2205119-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G191360	`PF10224`	DUF2205	14	29	0.087	13.6
TkA04G191360	`PF21265`	SBB_T7	15	68	0.061	13.7
TkA04G191360	`PF10224`	DUF2205	38	58	0.087	13.6
TkA04G191360	`PF24938`	DUF7755	56	100	0.14	12.4
TkA04G191360	`PF10224`	DUF2205	75	86	0.087	13.6
TkA04G191360	`PF21265`	SBB_T7	97	125	0.061	13.7
TkA04G191360	`PF10224`	DUF2205	119	137	0.087	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card