TkA04G191080 | RubberDandelionOmics

Gene overview

TkA04G191080

Reference: TK1151 Chr: Chr04 Coordinates: 49307437-49311657 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1316 bp · TkA04G191080|TK1151|cDNA

CATTTCTCACCGCGTCCCCTCTTTTTTCTCACTGTGTGTTGTGTGTGTGTGCTTTCACAAAGCTGCGAAAATTCTTTAGAGCTTTGCTCGATCAAACCCCGCTAGATTCAATCGCAACCTACATACACTAACCTGCTTATTAATCTCTTAAAAACTCTTGTGTGTTTTAGCTCCCTGAATCTGCAAAACTCGTCTCTCTCTCCGATGGAGTGGATCTTCTCCTTCCGTCGTTTACTGTAATGCCCTTTCTTGTTTAAATG...

CDS

Download CDS FASTA

642 bp · TkA04G191080|TK1151|CDS

ATGGGCTGCTTTCATTCTACTGTTAGAAAACCGGTTCCTGGACATGAAAACCCTACTATTCTTGCTTCTCAAACAGCCTTCAGTGTCAGTGAAGTTGAAGCACTATTTGAGCTCTTCAAGAGCATAAGCAGTTCTGTAATCGATGATGGATTAATTAACAAGGAAGAATTTCAACTAGCTTTATTCAAGAACAGGAAGAAAGAGAATTTATTTGCAAACAGGATATTTGATCTTTTTGATGTGAAACAAAAGGGTGTTAT...

Protein

Download Protein FASTA

213 aa · TkA04G191080|TK1151|PROTEIN

MGCFHSTVRKPVPGHENPTILASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLALFKNRKKENLFANRIFDLFDVKQKGVIDFGDFVRALNVFHPNAPQEDKISFCFKLYDMDGTGFIERQEVKQMLIALLCESELKLADDTIEIILDKTFSEADVDQDGKIDKSEWHNFVTKNPSLLKIMTLPYLRDITTTFPSFVFNSEVEEIAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G191080`
TK1151 ID	TkA04G191080
OH-1004 ID	LXL04_029859
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G191080

Location Chr04:49307437-49311657 (-)

Description Similar to CBL9: Calcineurin B-like protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47100`	Acts as a calcium sensor involved in abscisic acid (ABA) signaling and stress-induced ABA biosynthesis pathways.	The calcium sensor calcineurin B-like 9 modulates abscisic acid sensitivity and biosynthesis in Arabidopsis.2004 · DOI: 10.1105/tpc.021311 A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 Two calcineurin B-like calcium sensors, interacting with protein kinase CIPK23, regulate leaf transpiration and root potassium uptake in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03236.x The Calcineurin B-like calcium sensors CBL1 and CBL9 together with their interacting protein kinase CIPK26 regulate the Arabidopsis NADPH oxidase RBOHF.2013 · DOI: 10.1093/mp/sst009
`At4g17615`	Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses.	A calcium sensor and its interacting protein kinase are global regulators of abscisic acid signaling in Arabidopsis.2002 · DOI: 10.1016/s1534-5807(02)00229-0 CBL1, a calcium sensor that differentially regulates salt, drought, and cold responses in Arabidopsis.2003 · DOI: 10.1105/tpc.012393 The calcium sensor CBL1 integrates plant responses to abiotic stresses.2003 · DOI: 10.1046/j.1365-313x.2003.01892.x A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 Two calcineurin B-like calcium sensors, interacting with protein kinase CIPK23, regulate leaf transpiration and root potassium uptake in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03236.x The Calcineurin B-like calcium sensors CBL1 and CBL9 together with their interacting protein kinase CIPK26 regulate the Arabidopsis NADPH oxidase RBOHF.2013 · DOI: 10.1093/mp/sst009 A novel role for Arabidopsis CBL1 in affecting plant responses to glucose and gibberellin during germination and seedling development.2013 · DOI: 10.1371/journal.pone.0056412
`At4g26570`	Acts as a calcium sensor.	A protein kinase, calcineurin B-like protein-interacting protein Kinase9, interacts with calcium sensor calcineurin B-like Protein3 and regulates potassium homeostasis under low-potassium stress in Arabidopsis.2013 · DOI: 10.1104/pp.112.206896

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0564800`	Acts as a calcium sensor.	No verified direct reference in this release
`Os03g0626800`	Acts as a calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029859 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT4G17615

ath:AT5G47100

ath:AT5G55990

dosa:Os02g0291000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA04G191080 · TK1151

Cell membrane0.335

Rank 2 · TkA04G191080 · TK1151

Nucleus0.164

Rank 3 · TkA04G191080 · TK1151

Lysosome / Vacuole0.141

Rank 4 · TkA04G191080 · TK1151

Golgi apparatus0.111

Rank 5 · TkA04G191080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499EF-hand_727-58 aa

PF12763EH32-97 aa

PF13405EF-hand_648-61 aa

PF13499EF-hand_748-95 aa

PF00036EF-hand_149-61 aa

PF13202EF-hand_549-58 aa

PF13833EF-hand_849-57 aa

PF13833EF-hand_849-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G191080	`PF13499`	EF-hand_7	27	58	9.5e-15	55.4
TkA04G191080	`PF12763`	EH	32	97	0.00019	22.0
TkA04G191080	`PF13405`	EF-hand_6	48	61	4.1e-17	60.9
TkA04G191080	`PF13499`	EF-hand_7	48	95	9.5e-15	55.4
TkA04G191080	`PF00036`	EF-hand_1	49	61	4.5e-20	70.3
TkA04G191080	`PF13202`	EF-hand_5	49	58	1.3e-14	53.6
TkA04G191080	`PF13833`	EF-hand_8	49	57	2.9e-08	34.0
TkA04G191080	`PF13833`	EF-hand_8	49	96	2.9e-08	34.0
TkA04G191080	`PF24548`	EF_EFCAB10_C	49	58	0.001	19.4
TkA04G191080	`PF30347`	RSA-1_C	58	133	0.0012	19.8
TkA04G191080	`PF23564`	EF-hand_FSTL1	63	97	1.1e-05	26.5
TkA04G191080	`PF30624`	EF_SSP120	64	92	1.3e-05	26.5
TkA04G191080	`PF00036`	EF-hand_1	73	97	4.5e-20	70.3
TkA04G191080	`PF13405`	EF-hand_6	73	97	4.1e-17	60.9
TkA04G191080	`PF14658`	EF-hand_9	73	122	0.023	15.9
TkA04G191080	`PF13499`	EF-hand_7	74	104	9.5e-15	55.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTB8`	Arabidopsis thaliana	sp\|Q9LTB8\|CNBL9_ARATH Calcineurin B-like protein 9	85.400%	Swiss-Prot	High
`O81445`	Arabidopsis thaliana	sp\|O81445\|CNBL1_ARATH Calcineurin B-like protein 1	83.600%	Swiss-Prot	High
`Q8LEM7`	Arabidopsis thaliana	sp\|Q8LEM7\|CNBL3_ARATH Calcineurin B-like protein 3	64.900%	Swiss-Prot	High
`Q7XC27`	Oryza sativa subsp. japonica	sp\|Q7XC27\|CNBL1_ORYSJ Calcineurin B-like protein 1	80.300%	Swiss-Prot	High
`Q75LU8`	Oryza sativa subsp. japonica	sp\|Q75LU8\|CNBL3_ORYSJ Calcineurin B-like protein 3	65.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card