RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G185180
Reference: TK1151 Chr: Chr04 Coordinates: 47864172-47868055 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3257 bp · TkA04G185180|TK1151|cDNA

AGAACTAGAAAATATATATTGCCAAAAAAAGGTACAATTATGGAATCTTGATAAAGGAAAGCTAAAAAGTATAAGAAAAACTATGGCGTTTAGTCAACCACTGGGCCCGGTTGTTGCCCCTAAAACGCGTTTTAGCCAACTTTTGCTGCTACTAACGGACAAGCTTCCAAAATTTTCAAATCGGAGGATGATACGCTCATGATTTTTGCTTCCATTTTGCTTTTAAATTCACACCCAAAAATTTGCGAGGAAACTTCGCC...

CDS

Download CDS FASTA

2529 bp · TkA04G185180|TK1151|CDS

ATGGAATTTCGCAAAATCAGATTGCTTATATGGGTCATGTCCACAATGTGTTTGATAAATTGCTCCATCCAGTTCGAGCCTATAGACAACTACCTGCTAGATTGTGGATCACCCACGAACAGCTCCATACGTGATAGGGTTTTCTTAGCGGATACTTCCGATTACCGTTTCCTTTCAAACCCCGAACAAGCATCCGTAAGCGCATCAAATTCTCAACCTATTTCATCCACCTACGGATCTTCATTATACAGAACCGCTAG...

Protein

Download Protein FASTA

843 aa · TkA04G185180|TK1151|PROTEIN

MEFRKIRLLIWVMSTMCLINCSIQFEPIDNYLLDCGSPTNSSIRDRVFLADTSDYRFLSNPEQASVSASNSQPISSTYGSSLYRTARIVNKTSNYTFSINQHGRHFIRLYFFPFPQNAGTYNLSTARFSVSAHGFTLLKNFQPDNTPVVKEYSLNITSDELILTFTPSLNSFAFLNALEVISHPGELIPATARAVELPRNHNNLMTQALQTVARVNMGNQTVSPDNDTLWRLWSPDGTFMKHNSLVRFVSNISAVNYTAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G185180
TK1151 IDTkA04G185180
OH-1004 IDLXL04_008664
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)45.000
Protein coverage (%)TK1151 90.747 / OH-1004 92.127
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G185180
LocationChr04:47864172-47868055 (+)
DescriptionSimilar to At5g61350: Probable receptor-like protein kinase At5g61350
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release
At2g39360 Probable receptor-like protein kinase At2g39360. No verified direct reference in this release
At5g54380 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At4g39110 Probable receptor-like protein kinase At4g39110. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008664 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009555 pollen development Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0051924 regulation of calcium ion transport Biological Process
GO:0080092 regulation of pollen tube growth Biological Process
GO:0080147 root hair cell development Biological Process
GO:0097275 intracellular ammonium homeostasis Biological Process
GO:0005576 extracellular region Cellular Component
KEGG gene cross-reference
ath:AT2G21480
ath:AT3G46290
ath:AT4G39110
ath:AT5G54380
ath:AT5G61350
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.784
Rank 1 · TkA04G185180 · TK1151
Endoplasmic reticulum0.107
Rank 2 · TkA04G185180 · TK1151
Cytoplasm0.086
Rank 3 · TkA04G185180 · TK1151
Lysosome / Vacuole0.064
Rank 4 · TkA04G185180 · TK1151
Nucleus0.048
Rank 5 · TkA04G185180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819Malectin_like33-387 aa
PF11721Malectin33-142 aa
PF01636APH258-272 aa
PF11721Malectin301-337 aa
PF15102TMEM154403-442 aa
PF00069Pkinase416-438 aa
PF00069Pkinase484-694 aa
PF07714PK_Tyr_Ser-Thr485-687 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G185180PF12819Malectin_like333872.7e-2486.8
TkA04G185180PF11721Malectin331421.6e-0629.0
TkA04G185180PF01636APH2582720.01316.0
TkA04G185180PF11721Malectin3013371.6e-0629.0
TkA04G185180PF15102TMEM1544034420.03614.6
TkA04G185180PF00069Pkinase4164382.8e-42145.7
TkA04G185180PF00069Pkinase4846942.8e-42145.7
TkA04G185180PF07714PK_Tyr_Ser-Thr4856871.5e-46159.6
TkA04G185180PF03109ABC14865130.02314.6
TkA04G185180PF03109ABC16016350.02314.6
TkA04G185180PF01636APH6026390.01316.0
TkA04G185180PF11721Malectin7147401.6e-0629.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 148.700%Swiss-ProtMedium
Q9FN92Arabidopsis thalianasp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g5970050.300%Swiss-ProtHigh
O80623Arabidopsis thalianasp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g3936050.000%Swiss-ProtHigh
Q9LK35Arabidopsis thalianasp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 142.700%Swiss-ProtMedium
Q9T020Arabidopsis thalianasp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g3911043.700%Swiss-ProtMedium

JBrowse

View in Genome Browser