TkA04G178330 | RubberDandelionOmics

Gene overview

TkA04G178330

Reference: TK1151 Chr: Chr04 Coordinates: 46136357-46146794 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · TkA04G178330|TK1151|cDNA

ATGCAACCTCCAGCTCAGGAGTTGGTTGCTAGAGATTTACACGATCAATCATGGACATTCAGACATATTTATCGAGGTCAACCAAAGAGGCATCTATTAACAACAGGGTGGAGCATTTTTGTGAATTCGAAAAGGCTTTTTGCCGGTGACGAAGTTTTGTTTGTGAGAAATGAGAAATCACAGCTTCTGTTAGGAATAAGATGCGCTAACAGACAACAGCCTGCTCTGTCTTCATCAGTTATATCGAGTGACAGTATGCA...

CDS

Download CDS FASTA

765 bp · TkA04G178330|TK1151|CDS

ATGCAACCTCCAGCTCAGGAGTTGGTTGCTAGAGATTTACACGATCAATCATGGACATTCAGACATATTTATCGAGGTCAACCAAAGAGGCATCTATTAACAACAGGGTGGAGCATTTTTGTGAATTCGAAAAGGCTTTTTGCCGGTGACGAAGTTTTGTTTGTGAGAAATGAGAAATCACAGCTTCTGTTAGGAATAAGATGCGCTAACAGACAACAGCCTGCTCTGTCTTCATCAGTTATATCGAGTGACAGTATGCA...

Protein

Download Protein FASTA

254 aa · TkA04G178330|TK1151|PROTEIN

MQPPAQELVARDLHDQSWTFRHIYRGQPKRHLLTTGWSIFVNSKRLFAGDEVLFVRNEKSQLLLGIRCANRQQPALSSSVISSDSMHIGILAAAAHAAANNSPFTIYYNPRASPKLLVLTSPAEFVIPLAKYNKAMYTQVSLGMRFRMMFKTEESGVRRYMGTVTGISDFDSVRWKSSNGVVFRVGWDESAGGDRPSRVSVWEIEPVVTPFYMCPPPFLRQKFPQQFGKLSVITDMNLDRICCSLPSYFQFFCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G178330`
TK1151 ID	TkA04G178330
OH-1004 ID	LXL04_027786
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 98.425 / OH-1004 26.829 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G178330

Location Chr04:46136357-46146794 (+)

Description Similar to ARF19: Auxin response factor 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19220`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	A role for auxin response factor 19 in auxin and ethylene signaling in Arabidopsis.2006 · DOI: 10.1104/pp.105.070987 ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047761 Arabidopsis ATXR2 deposits H3K36me3 at the promoters of LBD genes to facilitate cellular dedifferentiation.2017 · DOI: 10.1126/scisignal.aan0316
`At5g20730`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	Overlapping and non-redundant functions of the Arabidopsis auxin response factors MONOPTEROS and NONPHOTOTROPIC HYPOCOTYL 4.2004 · DOI: 10.1242/dev.00925 A gradient of auxin and auxin-dependent transcription precedes tropic growth responses.2006 · DOI: 10.1073/pnas.0507127103 A role for auxin response factor 19 in auxin and ethylene signaling in Arabidopsis.2006 · DOI: 10.1104/pp.105.070987 ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047761 Arabidopsis ATXR2 deposits H3K36me3 at the promoters of LBD genes to facilitate cellular dedifferentiation.2017 · DOI: 10.1126/scisignal.aan0316

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YAA5`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os06g0196700`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os06g0702600`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027786 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009630 gravitropism Biological Process

GO:0009638 phototropism Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0010311 lateral root formation Biological Process

GO:0040008 regulation of growth Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048366 leaf development Biological Process

KEGG gene cross-reference

ath:AT1G19220

ath:AT5G20730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · TkA04G178330 · TK1151

Cytoplasm0.088

Rank 2 · TkA04G178330 · TK1151

Cell membrane0.026

Rank 3 · TkA04G178330 · TK1151

Plastid0.019

Rank 4 · TkA04G178330 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA04G178330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B36-67 aa

PF25313BRWD_AD49-62 aa

PF02362B377-98 aa

PF25313BRWD_AD121-207 aa

PF06507ARF_AD125-207 aa

PF02362B3174-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G178330	`PF02362`	B3	6	67	1.6e-14	54.4
TkA04G178330	`PF25313`	BRWD_AD	49	62	0.00014	22.6
TkA04G178330	`PF02362`	B3	77	98	1.6e-14	54.4
TkA04G178330	`PF25313`	BRWD_AD	121	207	0.00014	22.6
TkA04G178330	`PF06507`	ARF_AD	125	207	1.4e-29	102.5
TkA04G178330	`PF02362`	B3	174	189	1.6e-14	54.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RYC8`	Arabidopsis thaliana	sp\|Q8RYC8\|ARFS_ARATH Auxin response factor 19	75.500%	Swiss-Prot	High
`P93022`	Arabidopsis thaliana	sp\|P93022\|ARFG_ARATH Auxin response factor 7	75.500%	Swiss-Prot	High
`A2YAA5`	Oryza sativa subsp. indica	sp\|A2YAA5\|ARFP_ORYSI Auxin response factor 16	75.900%	Swiss-Prot	High
`A3B9A0`	Oryza sativa subsp. japonica	sp\|A3B9A0\|ARFP_ORYSJ Auxin response factor 16	75.900%	Swiss-Prot	High
`Q0D9R7`	Oryza sativa subsp. japonica	sp\|Q0D9R7\|ARFS_ORYSJ Auxin response factor 19	74.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card