TkA04G169910 | RubberDandelionOmics

Gene overview

TkA04G169910

Reference: TK1151 Chr: Chr04 Coordinates: 43879106-43882832 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1859 bp · TkA04G169910|TK1151|cDNA

GAAAAGACAAACACAATTACAATTCTCCATTAATTCGGAAACAATACCTCTCATCACCGGTTCCGAATGGGATACATGACACCCACCTCCCATAACCCTTTCTTCTTACTCCACCCTCCTTTTCTCTCTCTAGAACCAGAAATGGAGACTTACGAAAGCTGTTAAAACACTGGATAATTTAAGCAAAATCCTCAGAAAACCAGCACTTCATCCACCACTTCATTTCAGACAATCACCTTTCACCGAATTCATCCTTAATT...

CDS

Download CDS FASTA

1287 bp · TkA04G169910|TK1151|CDS

ATGATTTACCGGAAAAATAACCACCTCTCTGTCTCCGTCGTCCTCCTCTCTGTTTTCCTCATCGGAATCATCTTCTACGACGAAGACGTTAAATCACTAACACGATTACCGTTCTCTACCCCTAAGTCTCAAAAAACACAACCCCCACATATCCCGCATTCCGAATCCGACATTAATGAGCAACGGTCCACGAAGTTGGCGGCAGAAGATGATCAAGAAATCGAATTTCCACCGGAAACCTGCGATATTTTCGATGGAAA...

Protein

Download Protein FASTA

428 aa · TkA04G169910|TK1151|PROTEIN

MIYRKNNHLSVSVVLLSVFLIGIIFYDEDVKSLTRLPFSTPKSQKTQPPHIPHSESDINEQRSTKLAAEDDQEIEFPPETCDIFDGKWVFDDLTHPLYKEDECEFLTEQVTCMKNGRQNSMYQKWRWQPKGCNLPKFRGKLLAEKLKNKRLMFVGDSLNRNQWESMVCMVQSVVSPGRKSLVKTGSLSIFRIEDYNATVEFYWAPFLVQSNSDDPRIHNILDRIIMPESINIHGQNWKNVDYLVFNTYIWWMNTANMKVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G169910`
TK1151 ID	TkA04G169910
OH-1004 ID	LXL04_012224
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.400
Protein coverage (%)	TK1151 98.832 / OH-1004 95.319 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G169910

Location Chr04:43879106-43882832 (+)

Description Similar to ESK1: Protein ESKIMO 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55990`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.2007 · DOI: 10.1111/j.1365-313x.2006.02994.x Metabolome and water status phenotyping of Arabidopsis under abiotic stress cues reveals new insight into ESK1 function.2009 · DOI: 10.1111/j.1365-3040.2008.01898.x ESKIMO1 is a key gene involved in water economy as well as cold acclimation and salt tolerance.2008 · DOI: 10.1186/1471-2229-8-125 ESKIMO1 disruption in Arabidopsis alters vascular tissue and impairs water transport.2011 · DOI: 10.1371/journal.pone.0016645 The Arabidopsis DUF231 domain-containing protein ESK1 mediates 2-O- and 3-O-acetylation of xylosyl residues in xylan.2013 · DOI: 10.1093/pcp/pct070 Molecular Mechanism of Polysaccharide Acetylation by the Arabidopsis Xylan O-acetyltransferase XOAT1.2020 · DOI: 10.1105/tpc.20.00028
`At2g40150`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g40160`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0291800`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Biochemical characterization of rice xylan O-acetyltransferases.2018 · DOI: 10.1007/s00425-018-2882-1
`Os05g0354400`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Biochemical characterization of rice xylan O-acetyltransferases.2018 · DOI: 10.1007/s00425-018-2882-1
`Os01g0830700`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Biochemical characterization of rice xylan O-acetyltransferases.2018 · DOI: 10.1007/s00425-018-2882-1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012224 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050826 response to freezing Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

GO:1990538 xylan O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G40150

ath:AT3G55990

dosa:Os03g0291800

dosa:Os05g0354400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.605

Rank 1 · TkA04G169910 · TK1151

Cell membrane0.090

Rank 2 · TkA04G169910 · TK1151

Endoplasmic reticulum0.072

Rank 3 · TkA04G169910 · TK1151

Extracellular0.063

Rank 4 · TkA04G169910 · TK1151

Cytoplasm0.039

Rank 5 · TkA04G169910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416PMR5N79-133 aa

PF24536NXPE4_C127-229 aa

PF13839PC-Esterase134-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G169910	`PF14416`	PMR5N	79	133	1.6e-23	83.5
TkA04G169910	`PF24536`	NXPE4_C	127	229	0.00078	19.8
TkA04G169910	`PF13839`	PC-Esterase	134	422	8.4e-93	312.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY46`	Arabidopsis thaliana	sp\|Q9LY46\|TBL29_ARATH Xylan O-acetyltransferase 1	62.700%	Swiss-Prot	High
`Q94K00`	Arabidopsis thaliana	sp\|Q94K00\|TBL28_ARATH Protein trichome birefringence-like 28	61.600%	Swiss-Prot	High
`Q9SEZ9`	Arabidopsis thaliana	sp\|Q9SEZ9\|TBL30_ARATH Protein trichome birefringence-like 30	53.500%	Swiss-Prot	High
`Q10MX2`	Oryza sativa subsp. japonica	sp\|Q10MX2\|XOAT6_ORYSJ Xylan O-acetyltransferase 6	63.700%	Swiss-Prot	High
`A0A0P0WL81`	Oryza sativa subsp. japonica	sp\|A0A0P0WL81\|XOAT5_ORYSJ Xylan O-acetyltransferase 5	64.300%	Swiss-Prot	High
`Q8S237`	Oryza sativa subsp. japonica	sp\|Q8S237\|XOAT1_ORYSJ Xylan O-acetyltransferase 1	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card