TkA04G167650 | RubberDandelionOmics

Gene overview

TkA04G167650

Reference: TK1151 Chr: Chr04 Coordinates: 43331105-43334387 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2157 bp · TkA04G167650|TK1151|cDNA

GAGGAAACCGCATCCTCCTTCTTCCTTAATCAAACGCAGCAGCAACATCACACAACCCTAACCGTTGTTCACTTCTTCTTGGTTGGCTGGAGTTGAAATACGCGAAACAGAGAGAACCGAGAGTGAGAGAGTAACAGCGGGAGAGCGAGAGATAGAGCCGGTAGGAGTGACGAGCTCGCTGGAAAGAGGGTGGGGGCTGCCAGTTTTCGTGGAAAAGGAAGAGAGACTGCCGGTTTGCGAAGCTTTGTGAGCCATGGTGT...

CDS

Download CDS FASTA

1758 bp · TkA04G167650|TK1151|CDS

ATGGTGTCTAGCGAATCTCGTAATGAAAACAGAGCCTTAACCGATACTCGTTTCTCTGACCTCAATCCGCCCCTTTCCAATGAAGTCCTTGACGCACTATCTAATTCAGGCTTCGAATACTGCACTCCAGTTCAGGCAGCCACCATACCCTTGTTATGCAGCTACAAAGATGTCGCGGTGGACGCCGCCACCGGTTCCGGCAAAACCCTCGCCTTTGTCGTTCCACTCATCGAGATACTCCGGCGCACCACCACCGTTAA...

Protein

Download Protein FASTA

585 aa · TkA04G167650|TK1151|PROTEIN

MVSSESRNENRALTDTRFSDLNPPLSNEVLDALSNSGFEYCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLIEILRRTTTVKPHQVLGIIISPTRELSSQIFHVAQPFISSSLGDDVKPMLLVGGSEVKVDMKQIEDEGANLLIGTPGRLHDIMERMDILDFRSLEILILDEADRLLDMGFQKQINSIISRLPKLRRTGLFSATQTEAVEELSKAGLRNPVRVEVRAESKSSDHSASKTPSGLHIEFIKCEADRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G167650`
TK1151 ID	TkA04G167650
OH-1004 ID	LXL04_035508
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.400
Protein coverage (%)	TK1151 76.752 / OH-1004 69.524 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G167650

Location Chr04:43331105-43334387 (+)

Description Similar to Os03g0802700: DEAD-box ATP-dependent RNA helicase 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05450`	DEAD-box ATP-dependent RNA helicase 18.	No verified direct reference in this release
`At1g71370`	DEAD-box ATP-dependent RNA helicase 49.	No verified direct reference in this release
`At1g71280`	DEAD-box ATP-dependent RNA helicase 55.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0164500`	DEAD-box ATP-dependent RNA helicase 18.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035508 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0048866 stem cell fate specification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT3G18600

ath:AT5G65900

ddi:DDB_G0282741

dosa:Os03g0802700

dosa:Os06g0535100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.916

Rank 1 · TkA04G167650 · TK1151

Cytoplasm0.151

Rank 2 · TkA04G167650 · TK1151

Mitochondrion0.035

Rank 3 · TkA04G167650 · TK1151

Cell membrane0.017

Rank 4 · TkA04G167650 · TK1151

Golgi apparatus0.009

Rank 5 · TkA04G167650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD42-216 aa

PF04851ResIII57-203 aa

PF00271Helicase_C261-372 aa

PF13959CTE_SPB4422-471 aa

PF23681CTT_SPB4497-543 aa

PF04851ResIII504-544 aa

PF23681CTT_SPB4514-575 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G167650	`PF00270`	DEAD	42	216	4.6e-41	141.1
TkA04G167650	`PF04851`	ResIII	57	203	0.00033	21.3
TkA04G167650	`PF00271`	Helicase_C	261	372	9.4e-25	87.7
TkA04G167650	`PF13959`	CTE_SPB4	422	471	4.9e-16	59.2
TkA04G167650	`PF23681`	CTT_SPB4	497	543	5.7	8.2
TkA04G167650	`PF04851`	ResIII	504	544	0.00033	21.3
TkA04G167650	`PF23681`	CTT_SPB4	514	575	5.7	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLB0`	Arabidopsis thaliana	sp\|Q9FLB0\|RH18_ARATH DEAD-box ATP-dependent RNA helicase 18	67.100%	Swiss-Prot	High
`Q8GXD6`	Arabidopsis thaliana	sp\|Q8GXD6\|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49	63.100%	Swiss-Prot	High
`Q9FVV4`	Arabidopsis thaliana	sp\|Q9FVV4\|RH55_ARATH DEAD-box ATP-dependent RNA helicase 55	50.500%	Swiss-Prot	High
`Q761Z9`	Oryza sativa subsp. japonica	sp\|Q761Z9\|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18	65.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card