TkA04G162000 | RubberDandelionOmics

Gene overview

TkA04G162000

Reference: TK1151 Chr: Chr04 Coordinates: 41833362-41834541 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

833 bp · TkA04G162000|TK1151|cDNA

GCGCACTGCTTGACCCGGATCGCAGTTAAACCAGAGTACGGACCATCGCGTGTTTGTTTCAAATCTCACATTCTTTCTCTCAAGGTTCCGTTGCTAGGTAGAGAGATGGCAGAAGAGGAGAATGGGGCGGCCGGCGGCGGGGAGTTTTACCTGAGGTATTATGTAGGCCATAAAGGGAAGTTTGGCCACGAGTTCTTGGAGTTCGAGTTCCGACCAGACGGCAAACTCCGTTATGCCAATAACTCCAACTACAAGAACGA...

CDS

Download CDS FASTA

573 bp · TkA04G162000|TK1151|CDS

GCGCACTGCTTGACCCGGATCGCAGTTAAACCAGAGTACGGACCATCGCGTGTTTGTTTCAAATCTCACATTCTTTCTCTCAAGGTTCCGTTGCTAGGTAGAGAGATGGCAGAAGAGGAGAATGGGGCGGCCGGCGGCGGGGAGTTTTACCTGAGGTATTATGTAGGCCATAAAGGGAAGTTTGGCCACGAGTTCTTGGAGTTCGAGTTCCGACCAGACGGCAAACTCCGTTATGCCAATAACTCCAACTACAAGAACGA...

Protein

Download Protein FASTA

190 aa · TkA04G162000|TK1151|PROTEIN

AHCLTRIAVKPEYGPSRVCFKSHILSLKVPLLGREMAEEENGAAGGGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPSVLKECRRIVSDSEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLMDVQTSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G162000`
TK1151 ID	TkA04G162000
OH-1004 ID	LXL04_012089
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 81.579 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G162000

Location Chr04:41833362-41834541 (+)

Description Similar to MAGO2: Protein mago nashi homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02140`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	Functional interconnections of Arabidopsis exon junction complex proteins and genes at multiple steps of gene expression.2011 · DOI: 10.1093/jxb/err202 A New Mutation, hap1-2, Reveals a C Terminal Domain Function in AtMago Protein and Its Biological Effects in Male Gametophyte Development in Arabidopsis thaliana.2016 · DOI: 10.1371/journal.pone.0148200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0287200`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	Uncovering Divergence of Rice Exon Junction Complex Core Heterodimer Gene Duplication Reveals Their Essential Role in Growth, Development, and Reproduction.2014 · DOI: 10.1104/pp.114.237958 Targeting MAGO proteins with a peptide aptamer reinforces their essential roles in multiple rice developmental pathways.2014 · DOI: 10.1111/tpj.12672
`Os08g0107900`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	Uncovering Divergence of Rice Exon Junction Complex Core Heterodimer Gene Duplication Reveals Their Essential Role in Growth, Development, and Reproduction.2014 · DOI: 10.1104/pp.114.237958 Targeting MAGO proteins with a peptide aptamer reinforces their essential roles in multiple rice developmental pathways.2014 · DOI: 10.1111/tpj.12672

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012089 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006417 regulation of translation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0050684 regulation of mRNA processing Biological Process

GO:0051028 mRNA transport Biological Process

GO:2000622 regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

KEGG gene cross-reference

ath:AT1G02140

dosa:Os08g0107900

dosa:Os12g0287200

mmu:66441

osa:4351998

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.499

Rank 1 · TkA04G162000 · TK1151

Nucleus0.475

Rank 2 · TkA04G162000 · TK1151

Mitochondrion0.082

Rank 3 · TkA04G162000 · TK1151

Cell membrane0.072

Rank 4 · TkA04G162000 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA04G162000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02792Mago_nashi49-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G162000	`PF02792`	Mago_nashi	49	190	5.4e-79	263.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23676`	Arabidopsis thaliana	sp\|O23676\|MGN_ARATH Protein mago nashi homolog	90.200%	Swiss-Prot	High
`P49030`	Oryza sativa subsp. japonica	sp\|P49030\|MGN2_ORYSJ Protein mago nashi homolog 2	93.800%	Swiss-Prot	High
`A0A0P0XB70`	Oryza sativa subsp. japonica	sp\|A0A0P0XB70\|MGN1_ORYSJ Protein mago nashi homolog 1	91.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card