TkA04G154780 | RubberDandelionOmics

Gene overview

TkA04G154780

Reference: TK1151 Chr: Chr04 Coordinates: 40033839-40034265 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA04G154780|TK1151|cDNA

ATGAAAGAAGAGAATAAAAAGAAGAAAGAAGAAGCAGATGATAAAATAGAAGATGTGGTAATGCAAAGAATTATAACTAGGATTTTATTCAATGTGGGGGTGCCTTTGGTCACTGGATTAGGACGACTTTTATCACATTTGGAGCTTCCACACTTGGGATTGCATATGGGACTTTGTCGACTAGTTGGGATGCTGAGGAGAAGGGTTCGATTCTCGGGTTTGAAGAAGCTAAGCAGAATTGGGTTAACATGTGGGAAGAA...

CDS

Download CDS FASTA

357 bp · TkA04G154780|TK1151|CDS

ATGAAAGAAGAGAATAAAAAGAAGAAAGAAGAAGCAGATGATAAAATAGAAGATGTGGTAATGCAAAGAATTATAACTAGGATTTTATTCAATGTGGGGGTGCCTTTGGTCACTGGATTAGGACGACTTTTATCACATTTGGAGCTTCCACACTTGGGATTGCATATGGGACTTTGTCGACTAGTTGGGATGCTGAGGAGAAGGGTTCGATTCTCGGGTTTGAAGAAGCTAAGCAGAATTGGGTTAACATGTGGGAAGAA...

Protein

Download Protein FASTA

118 aa · TkA04G154780|TK1151|PROTEIN

MKEENKKKKEEADDKIEDVVMQRIITRILFNVGVPLVTGLGRLLSHLELPHLGLHMGLCRLVGMLRRRVRFSGLKKLSRIGLTCGKKMMVITFKVGSFVKYDVKCNCVFLIYSLLGTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G154780`
TK1151 ID	TkA04G154780
OH-1004 ID	LXL04_035204
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 27.119 / OH-1004 13.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G154780`
Location	Chr04:40033839-40034265 (-)
Description	Similar to At5g52780: Uncharacterized protein PAM68-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035204` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009642 response to light intensity Biological Process GO:0010207 photosystem II assembly Biological Process GO:0010258 NADH dehydrogenase complex (plastoquinone) assembly Biological Process GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0009523 photosystem II Cellular Component GO:0009533 chloroplast stromal thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009543 chloroplast thylakoid lumen Cellular Component
KEGG gene cross-reference	ath:AT4G19100 ath:AT5G52780 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.325

Rank 1 · TkA04G154780 · TK1151

Nucleus0.296

Rank 2 · TkA04G154780 · TK1151

Mitochondrion0.276

Rank 3 · TkA04G154780 · TK1151

Cell membrane0.105

Rank 4 · TkA04G154780 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkA04G154780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11947DUF34643-43 aa

PF11947DUF346478-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G154780	`PF11947`	DUF3464	3	43	2.4e-07	31.3
TkA04G154780	`PF11947`	DUF3464	78	85	2.4e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card