TkA04G153310 | RubberDandelionOmics

Gene overview

TkA04G153310

Reference: TK1151 Chr: Chr04 Coordinates: 39628753-39632093 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1990 bp · TkA04G153310|TK1151|cDNA

AAGGGCAGTCGAAGTTTAGCAAGCAACTCAACATTTGGGACAAATTAAGAACAAAAATTAGTAGTAAACTTGTATTGATACGATAACGTGGACATATTTGTTTGGATAGAGTATTAGCAGTCAAATCAGTTGGTTCGATTCTTTCAACGAATGATGTTTGGATTGAAAGGCCCATCCGGGTTCTCAAGGTTCTCAACGGCTGAGGAAGTTACCCAAGGGATCGATGGATCGGGTCTCACTGCCATTGTCACAGGTATGTA...

CDS

Download CDS FASTA

1083 bp · TkA04G153310|TK1151|CDS

ATGTCTTTTCGCAAGCCATGCATAGAAGACTTACCTCAAGCTATCATGGCCGATATACTCTCAAGACTTCCTTTGAAGATGATCATCCGTTGCAAGGGTGTATGCAAGCAGTTGCAGAATATAGTTTTTGACTCTTACTTCGCTGATCTTCAACTCTCGAGATCACGTGTACGCTTCACGATTCATTATAACTCTAAAATATTGAAGTGGGTGGCGATTGAAGACGAACTCGGTCACCACAATCTACACCTCGACCCTGT...

Protein

Download Protein FASTA

361 aa · TkA04G153310|TK1151|PROTEIN

MSFRKPCIEDLPQAIMADILSRLPLKMIIRCKGVCKQLQNIVFDSYFADLQLSRSRVRFTIHYNSKILKWVAIEDELGHHNLHLDPVMSLKFKLAPIIQLVGSVNGLVCMWQVNKTTDNTYICNPITREYMILPLPSQQYNREGLATTVAYCFGVGLLTPAYKVIRILQKDMIREGSTPTYRVSDAEVYTLGTGQWRSLSDHVPYSFRENRGVFLNGHAHWTIYHDKICAFDFDNETFELIPSPPSQRRRVYRQKLGVLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G153310`
TK1151 ID	TkA04G153310
OH-1004 ID	LXL04_035224
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.300
Protein coverage (%)	TK1151 100.000 / OH-1004 59.332 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G153310

Location Chr04:39628753-39632093 (+)

Description Similar to TIC32: Short-chain dehydrogenase TIC 32, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07870`	F-box protein At3g07870.	No verified direct reference in this release
`At1g53550`	Putative F-box protein At1g53550.	No verified direct reference in this release
`At1g55070`	Putative F-box protein At1g55070.	No verified direct reference in this release
`At1g70960`	Putative F-box protein At1g70960.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035224 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030178 negative regulation of Wnt signaling pathway Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0071560 cellular response to transforming growth factor beta stimulus Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G23430

bna:106397857

gga:415801

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · TkA04G153310 · TK1151

Nucleus0.374

Rank 2 · TkA04G153310 · TK1151

Cell membrane0.157

Rank 3 · TkA04G153310 · TK1151

Endoplasmic reticulum0.077

Rank 4 · TkA04G153310 · TK1151

Lysosome / Vacuole0.047

Rank 5 · TkA04G153310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like8-46 aa

PF00646F-box8-46 aa

PF29466F-box_COS1118-54 aa

PF08268FBA_381-292 aa

PF29466F-box_COS11196-118 aa

PF07734FBA_198-334 aa

PF03478Beta-prop_KIB1-498-266 aa

PF24750b-prop_At3g26010-like100-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G153310	`PF12937`	F-box-like	8	46	9.7e-07	29.2
TkA04G153310	`PF00646`	F-box	8	46	1.8e-05	25.1
TkA04G153310	`PF29466`	F-box_COS111	8	54	0.1	13.9
TkA04G153310	`PF08268`	FBA_3	81	292	3.2e-21	76.4
TkA04G153310	`PF29466`	F-box_COS111	96	118	0.1	13.9
TkA04G153310	`PF07734`	FBA_1	98	334	5.3e-20	72.4
TkA04G153310	`PF03478`	Beta-prop_KIB1-4	98	266	0.0013	19.0
TkA04G153310	`PF24750`	b-prop_At3g26010-like	100	288	4.6e-12	46.4
TkA04G153310	`PF31067`	Endolysin_A	172	193	0.17	12.4
TkA04G153310	`PF01344`	Kelch_1	182	201	0.1	12.9
TkA04G153310	`PF00646`	F-box	195	203	1.8e-05	25.1
TkA04G153310	`PF14908`	HU-CCDC81_euk_1	196	239	0.29	11.9
TkA04G153310	`PF01344`	Kelch_1	225	245	0.1	12.9
TkA04G153310	`PF31067`	Endolysin_A	274	291	0.17	12.4
TkA04G153310	`PF31067`	Endolysin_A	326	352	0.17	12.4
TkA04G153310	`PF00646`	F-box	331	345	1.8e-05	25.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFC7`	Arabidopsis thaliana	sp\|Q9SFC7\|FB135_ARATH F-box protein At3g07870	29.400%	Swiss-Prot	Low
`Q9LPH0`	Arabidopsis thaliana	sp\|Q9LPH0\|FB57_ARATH Putative F-box protein At1g53550	26.900%	Swiss-Prot	Low
`Q9C725`	Arabidopsis thaliana	sp\|Q9C725\|FB61_ARATH Putative F-box protein At1g55070	24.100%	Swiss-Prot	Low
`Q3ECE2`	Arabidopsis thaliana	sp\|Q3ECE2\|FB85_ARATH Putative F-box protein At1g70960	23.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card