TkA04G146540 | RubberDandelionOmics

Gene overview

TkA04G146540

Reference: TK1151 Chr: Chr04 Coordinates: 37955735-37957405 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1167 bp · TkA04G146540|TK1151|cDNA

ATGAACAAGAGTTCCATGGGTGTGTTAATGGAGAGTCATGATGAAGATGTTAATAGTTCAGAAACAAAGAAAAATAAAGTTATCTGGACACCAGATTTGCATCAGAAGTTCTTGGAAGCCATTGAAAAGATCGGAGTTCATGCTGTTCCAAAAAAAATCCTAGAACTGATGAAGGTGGAGGGATTAACTAGAGATCACATTGCTAGTCATTTACAGAAATACCGAATCTTCTTGAAGAAAATAGCTGATGCAAATAATCA...

CDS

Download CDS FASTA

1167 bp · TkA04G146540|TK1151|CDS

ATGAACAAGAGTTCCATGGGTGTGTTAATGGAGAGTCATGATGAAGATGTTAATAGTTCAGAAACAAAGAAAAATAAAGTTATCTGGACACCAGATTTGCATCAGAAGTTCTTGGAAGCCATTGAAAAGATCGGAGTTCATGCTGTTCCAAAAAAAATCCTAGAACTGATGAAGGTGGAGGGATTAACTAGAGATCACATTGCTAGTCATTTACAGAAATACCGAATCTTCTTGAAGAAAATAGCTGATGCAAATAATCA...

Protein

Download Protein FASTA

388 aa · TkA04G146540|TK1151|PROTEIN

MNKSSMGVLMESHDEDVNSSETKKNKVIWTPDLHQKFLEAIEKIGVHAVPKKILELMKVEGLTRDHIASHLQKYRIFLKKIADANNHVEIASKPSLLESSMINEDPWKKLPLISNQPTPQQMNFPSNSVMHEVMNPPVLDTSSFSFPFLKASSCDSTTSSELTHLRSSPNEGYSMQEAIKMSHNSLEDVNKLGIMNSGCVSHMQNLDGFMYDDGGSPSTEMGPFGGVYTNNELHMSWNHEYSYGFESDYSSHSGFVENGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G146540`
TK1151 ID	TkA04G146540
OH-1004 ID	LXL04_035287
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 95.276 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G146540

Location Chr04:37955735-37957405 (+)

Description Similar to ARR12: Two-component response regulator ARR12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16857`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 ARR1, a transcription factor for genes immediately responsive to cytokinins.2001 · DOI: 10.1126/science.1065201 A genetic framework for the control of cell division and differentiation in the root meristem.2008 · DOI: 10.1126/science.1164147
`At2g25180`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The rate of cell differentiation controls the Arabidopsis root meristem growth phase.2010 · DOI: 10.1016/j.cub.2010.05.035
`At5g58080`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	No verified direct reference in this release
`At4g16110`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis.2001 · DOI: 10.1007/s004380000400 Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.2004 · DOI: 10.1038/sj.emboj.7600337 Cytokinin-mediated control of leaf longevity by AHK3 through phosphorylation of ARR2 in Arabidopsis.2006 · DOI: 10.1073/pnas.0505150103
`At5g59570`	Transcription factor that is a critical component of the regulatory circuit of the circadian clock.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035287 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0010468 regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT2G25180

ath:AT3G16857

ath:AT3G46640

ath:AT5G59570

dosa:Os02g0182100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · TkA04G146540 · TK1151

Cytoplasm0.129

Rank 2 · TkA04G146540 · TK1151

Cell membrane0.028

Rank 3 · TkA04G146540 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA04G146540 · TK1151

Plastid0.012

Rank 5 · TkA04G146540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01285TEA26-48 aa

PF00249Myb_DNA-binding29-75 aa

PF01285TEA63-75 aa

PF15502MPLKIP100-127 aa

PF00249Myb_DNA-binding295-303 aa

PF15502MPLKIP357-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G146540	`PF01285`	TEA	26	48	0.085	13.9
TkA04G146540	`PF00249`	Myb_DNA-binding	29	75	1.8e-08	35.1
TkA04G146540	`PF01285`	TEA	63	75	0.085	13.9
TkA04G146540	`PF15502`	MPLKIP	100	127	1.8	9.5
TkA04G146540	`PF00249`	Myb_DNA-binding	295	303	1.8e-08	35.1
TkA04G146540	`PF15502`	MPLKIP	357	362	1.8	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940D0`	Arabidopsis thaliana	sp\|Q940D0\|ARR1_ARATH Two-component response regulator ARR1	53.300%	Swiss-Prot	Low
`P62598`	Arabidopsis thaliana	sp\|P62598\|ARR12_ARATH Two-component response regulator ARR12	38.200%	Swiss-Prot	Low
`Q9FGT7`	Arabidopsis thaliana	sp\|Q9FGT7\|ARR18_ARATH Two-component response regulator ARR18	61.700%	Swiss-Prot	Low
`Q9ZWJ9`	Arabidopsis thaliana	sp\|Q9ZWJ9\|ARR2_ARATH Two-component response regulator ARR2	54.300%	Swiss-Prot	Low
`Q9LTH4`	Arabidopsis thaliana	sp\|Q9LTH4\|PCLL_ARATH Transcription factor BOA	43.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card