RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G142710
Reference: TK1151 Chr: Chr04 Coordinates: 36905719-36911793 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3513 bp · TkA04G142710|TK1151|cDNA

AACAGAGGACAAGTGGACAACTGTGGCAAAATGTAGCCAGTTAGGGAAACGGCAGTACGAGTAGTGACGGCCGCTGCCACTTTTCTTCTTTTCCCCAACACCCTATTTACTAACGTCTATTCACCGCCGTTTGCCTCTCTCTCCCTCCCTCTTCTGCAACAACAGCAGTATTTTCTCTCTCTTCATAACAATTCGCCATTAAACACGACTATCCTCTCTCTGCCTTACAGTTCACGCCAAACGCCTGTTCTCTCTTCATT...

CDS

Download CDS FASTA

2898 bp · TkA04G142710|TK1151|CDS

ATGGAGCTTGGGTTACGTGTGTTAATGGCGGTTTTACTGATTCTGGTACCGTGTTCGACGTCTCTCAGCGACGAAGGGAAAGCTTTAATGTCTATAAAGGCGTCGTTTAGCAATATCGTGAATGTGCTACTGGATTGGGACGAAGATCAGAATGACGATCTCTGTTCATGGAGAGGGGTTCAATGTGATAATATCAGCACAACTGTTGTTGCTTTGAACCTGTCAAATTTGAACCTCGGAGGGGAAATTTCTCCGGCCAT...

Protein

Download Protein FASTA

965 aa · TkA04G142710|TK1151|PROTEIN

MELGLRVLMAVLLILVPCSTSLSDEGKALMSIKASFSNIVNVLLDWDEDQNDDLCSWRGVQCDNISTTVVALNLSNLNLGGEISPAIGDLRNLQSVDLQGNKLTGQIPDEIGSCVSLVLLDLSDNMLYGDIPFSISKLKQLELLNLKNNQITGPIPSTLTQIPNLKTLDLAQNRLTGEIPRLIYWNEVLQYLGLRGNSLTGTLSADMCQLTGLWYFDVRGNNLTGTIPDSIGNCTSFEILDISYNQISGEIPYNIGFLQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G142710
TK1151 IDTkA04G142710
OH-1004 IDLXL04_017905
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)62.400
Protein coverage (%)TK1151 43.627 / OH-1004 44.286
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G142710
LocationChr04:36905719-36911793 (-)
DescriptionSimilar to ERECTA: LRR receptor-like serine/threonine-protein kinase ERECTA
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g62230 Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ER and ERL2.
Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028
Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788
Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111
Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196
A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117
At5g07180 Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ERL1 and ER.
Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028
Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0130100 Receptor kinase involved in salt drought stress responses.
Receptor-like kinase OsSIK1 improves drought and salt stress tolerance in rice (Oryza sativa) plants.2010 · DOI: 10.1111/j.1365-313x.2010.04146.x
Os02g0777400 Receptor kinase that may be involved in the regulation of cell proliferation and cell growth. No verified direct reference in this release
Os06g0203800 Receptor kinase involved in the regulation of thermotolerance. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017905 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001558 regulation of cell growth Biological Process
GO:0009553 embryo sac development Biological Process
GO:0009664 plant-type cell wall organization Biological Process
GO:0009944 polarity specification of adaxial/abaxial axis Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010103 stomatal complex morphogenesis Biological Process
GO:0010148 transpiration Biological Process
GO:0010286 heat acclimation Biological Process
GO:0030155 regulation of cell adhesion Biological Process
GO:0042659 regulation of cell fate specification Biological Process
GO:0042742 defense response to bacterium Biological Process
KEGG gene cross-reference
ath:AT2G26330
ath:AT5G62230
dosa:Os02g0777400
dosa:Os06g0130100
dosa:Os06g0203800
osa:4340000
osa:4340427
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.874
Rank 1 · TkA04G142710 · TK1151
Endoplasmic reticulum0.080
Rank 2 · TkA04G142710 · TK1151
Cytoplasm0.064
Rank 3 · TkA04G142710 · TK1151
Nucleus0.041
Rank 4 · TkA04G142710 · TK1151
Lysosome / Vacuole0.025
Rank 5 · TkA04G142710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_223-63 aa
PF29252LRR_NLRC462-127 aa
PF13516LRR_666-76 aa
PF24141LRR_ComC68-133 aa
PF24048LRR_NXF1-570-108 aa
PF00560LRR_171-90 aa
PF12799LRR_472-103 aa
PF23598LRR_1485-170 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G142710PF08263LRRNT_223632.5e-0938.0
TkA04G142710PF29252LRR_NLRC4621272.18.2
TkA04G142710PF13516LRR_666760.003318.1
TkA04G142710PF24141LRR_ComC681331.1e-0835.8
TkA04G142710PF24048LRR_NXF1-5701080.3211.3
TkA04G142710PF00560LRR_171906.9e-57177.8
TkA04G142710PF12799LRR_4721032.8e-33113.9
TkA04G142710PF23598LRR_14851701.2e-29103.9
TkA04G142710PF13855LRR_8861272.3e-40136.9
TkA04G142710PF23211LRR_LRWD1871740.0002121.8
TkA04G142710PF13516LRR_6911050.003318.1
TkA04G142710PF24048LRR_NXF1-5911460.3211.3
TkA04G142710PF00560LRR_1921146.9e-57177.8
TkA04G142710PF14580LRR_9951799.86.4
TkA04G142710PF00706Toxin_4971140.01116.8
TkA04G142710PF25372LRR_FBXL15981540.08212.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGW6Arabidopsis thalianasp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL170.500%Swiss-ProtLow
Q6XAT2Arabidopsis thalianasp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL271.100%Swiss-ProtLow
Q658G7Oryza sativa subsp. japonicasp|Q658G7|SIK1_ORYSJ LRR receptor-like serine/threonine-protein kinase SIK168.100%Swiss-ProtLow
I1Z695Oryza sativa subsp. japonicasp|I1Z695|EREC2_ORYSJ LRR receptor-like serine/threonine-protein kinase ER261.300%Swiss-ProtLow
Q69SP5Oryza sativa subsp. japonicasp|Q69SP5|EREC1_ORYSJ LRR receptor-like serine/threonine-protein kinase ER158.000%Swiss-ProtLow

JBrowse

View in Genome Browser