TkA04G141830 | RubberDandelionOmics

Gene overview

TkA04G141830

Reference: TK1151 Chr: Chr04 Coordinates: 36666914-36668768 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

946 bp · TkA04G141830|TK1151|cDNA

TTGATTAAGCTTCTTTTAATCGGCAACAATGTTTTGGTACAGAGTTGTCTCCTTTTTGGTTTCTCAGATGGTTCCTTCACTACTAGTGTCATTACAGCCATAGGTACTGATTTCCAGATAAGGACCATTGCGCTTGATGGAAAACAAATCAAACTCCAAATTTGGGACACTACTTGCCAAGGACGATTTAGAGCAATCACAGCCGGTTATACATCCTATTACCGTGGAGCCATGGATATTCAACTGGTGTATGATATAAC...

CDS

Download CDS FASTA

420 bp · TkA04G141830|TK1151|CDS

TTGATTAAGCTTCTTTTAATCGGCAACAATGTTTTGGTACAGAGTTGTCTCCTTTTTGGTTTCTCAGATGGTTCCTTCACTACTAGTGTCATTACAGCCATAGGTACTGATTTCCAGATAAGGACCATTGCGCTTGATGGAAAACAAATCAAACTCCAAATTTGGGACACTACTTGCCAAGGACGATTTAGAGCAATCACAGCCGGTTATACATCCTATTACCGTGGAGCCATGGATATTCAACTGGTGTATGATATAAC...

Protein

Download Protein FASTA

139 aa · TkA04G141830|TK1151|PROTEIN

LIKLLLIGNNVLVQSCLLFGFSDGSFTTSVITAIGTDFQIRTIALDGKQIKLQIWDTTCQGRFRAITAGYTSYYRGAMDIQLVYDITGESISLGIKNWIHNIEQHAFDKVNKILVGSKSDMDNGHKVAPASKGQTLGNE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G141830`
TK1151 ID	TkA04G141830
OH-1004 ID	LXL04_012612
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.900
Protein coverage (%)	TK1151 100.000 / OH-1004 62.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G141830

Location Chr04:36666914-36668768 (-)

Description Similar to RABE1A: Ras-related protein RABE1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53610`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At3g46060`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At3g09900`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At5g03520`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012612 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT3G09900

ath:AT3G46060

ath:AT3G53610

ath:AT5G03520

bvg:104900163

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA04G141830 · TK1151

Nucleus0.158

Rank 2 · TkA04G141830 · TK1151

Mitochondrion0.078

Rank 3 · TkA04G141830 · TK1151

Extracellular0.074

Rank 4 · TkA04G141830 · TK1151

Endoplasmic reticulum0.068

Rank 5 · TkA04G141830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071Ras3-135 aa

PF08477Roc3-120 aa

PF00025Arf3-127 aa

PF02599CsrA34-54 aa

PF02599CsrA83-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G141830	`PF00071`	Ras	3	135	4.1e-30	105.2
TkA04G141830	`PF08477`	Roc	3	120	1.7e-15	58.0
TkA04G141830	`PF00025`	Arf	3	127	0.023	14.9
TkA04G141830	`PF02599`	CsrA	34	54	0.19	12.5
TkA04G141830	`PF02599`	CsrA	83	96	0.19	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24466`	Arabidopsis thaliana	sp\|O24466\|RAE1A_ARATH Ras-related protein RABE1a	66.900%	Swiss-Prot	High
`P28186`	Arabidopsis thaliana	sp\|P28186\|RAE1C_ARATH Ras-related protein RABE1c	66.200%	Swiss-Prot	High
`Q9SF91`	Arabidopsis thaliana	sp\|Q9SF91\|RAE1E_ARATH Ras-related protein RABE1e	64.000%	Swiss-Prot	High
`Q9LZD4`	Arabidopsis thaliana	sp\|Q9LZD4\|RAE1D_ARATH Ras-related protein RABE1d	63.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card