TkA04G141370 | RubberDandelionOmics

Gene overview

TkA04G141370

Reference: TK1151 Chr: Chr04 Coordinates: 36529849-36532225 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1500 bp · TkA04G141370|TK1151|cDNA

TTTTTCTGTAGTCATCAGCTTCCACAACAATCTTTCACCATAAAAAAAGAACACCTTAAATACCCTCTTCGGCTCTCAATTCTTAAACCACTCCAAAAAGCAAAAATGGTGAACACCAGAACCAAACTCCAGAAAATCAACAACTCCATGAAGCTCTGCCTTTCAGAGGCGGCTATGGCGGATTCCGATCAACTGGCGACCAAGTCTGGACATTTGATCGGTTCCAACGATGATCTTTTAATGGAAATCCTTCTCCGGCT...

CDS

Download CDS FASTA

1347 bp · TkA04G141370|TK1151|CDS

TTTTTCTGTAGTCATCAGCTTCCACAACAATCTTTCACCATAAAAAAAGAACACCTTAAATACCCTCTTCGGCTCTCAATTCTTAAACCACTCCAAAAAGCAAAAATGGTGAACACCAGAACCAAACTCCAGAAAATCAACAACTCCATGAAGCTCTGCCTTTCAGAGGCGGCTATGGCGGATTCCGATCAACTGGCGACCAAGTCTGGACATTTGATCGGTTCCAACGATGATCTTTTAATGGAAATCCTTCTCCGGCT...

Protein

Download Protein FASTA

448 aa · TkA04G141370|TK1151|PROTEIN

FFCSHQLPQQSFTIKKEHLKYPLRLSILKPLQKAKMVNTRTKLQKINNSMKLCLSEAAMADSDQLATKSGHLIGSNDDLLMEILLRLPVTSVLRFKSVSKHWRSLLSHRNFTLLYKTASNSPGLFVRNLYIPFDVDRPHTPPFRNLDFYPDLCGIRIVQSCNGLLLCCSKRGHERARKYYVFNPTTKQFALIPSVPGGMDVRKTIRFMGLAFHQTDCAHYKVICIHVVKPDDLFKIQVYSSDTGKWKISDQSFSAPYYTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G141370`
TK1151 ID	TkA04G141370
OH-1004 ID	LXL04_035344
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 51.554 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G141370

Location Chr04:36529849-36532225 (-)

Description Similar to At5g07610: F-box protein At5g07610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release
`At5g49610`	F-box protein At5g49610.	No verified direct reference in this release
`At4g19940`	F-box protein At4g19940.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At2g43440`	F-box protein At2g43440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035344 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G16210

ath:AT5G07610

ath:AT5G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA04G141370 · TK1151

Nucleus0.531

Rank 2 · TkA04G141370 · TK1151

Cell membrane0.079

Rank 3 · TkA04G141370 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA04G141370 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA04G141370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03478Beta-prop_KIB1-465-81 aa

PF00646F-box77-112 aa

PF12937F-box-like77-108 aa

PF03478Beta-prop_KIB1-4150-349 aa

PF08268FBA_3151-277 aa

PF07734FBA_1155-276 aa

PF24750b-prop_At3g26010-like157-368 aa

PF03791KNOX2355-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G141370	`PF03478`	Beta-prop_KIB1-4	65	81	0.00042	20.6
TkA04G141370	`PF00646`	F-box	77	112	4.5e-08	33.4
TkA04G141370	`PF12937`	F-box-like	77	108	0.00049	20.5
TkA04G141370	`PF03478`	Beta-prop_KIB1-4	150	349	0.00042	20.6
TkA04G141370	`PF08268`	FBA_3	151	277	7.7e-07	29.2
TkA04G141370	`PF07734`	FBA_1	155	276	3e-13	50.2
TkA04G141370	`PF24750`	b-prop_At3g26010-like	157	368	1.1e-11	45.1
TkA04G141370	`PF03791`	KNOX2	355	372	0.18	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU24`	Arabidopsis thaliana	sp\|Q9LU24\|FB145_ARATH Putative F-box protein At3g16210	32.100%	Swiss-Prot	Low
`Q9FGY4`	Arabidopsis thaliana	sp\|Q9FGY4\|FB341_ARATH F-box protein At5g49610	29.500%	Swiss-Prot	Low
`O49421`	Arabidopsis thaliana	sp\|O49421\|FB238_ARATH F-box protein At4g19940	28.000%	Swiss-Prot	Low
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	24.400%	Swiss-Prot	Low
`A8MS20`	Arabidopsis thaliana	sp\|A8MS20\|FB350_ARATH F-box protein At2g43440	27.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card