Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2303 bp · TkA04G139190|TK1151|cDNA
TTGACTTTGAATTTAATTCTGTTATTTTTCTTAAAAATACTAATTTTACAGGACGCGGCTCAGGACACACCTCTCCTACTATTCTCCTCTCTCTCTCTCTCTAGAACACACAGACACACACCAAATTCACCAAACCAAACACCAATTGTGAAAATTCCGGCAACAAAACAAAGGATGCCGCTTTGCGACGTCGGAAAATACCAGTCTGGCGGCGATGCAGTTCTCAACAATGGTATAAAGATTTTCTACAGAACCTACGG...
1302 bp · TkA04G139190|TK1151|CDS
TTGACTTTGAATTTAATTCTGTTATTTTTCTTAAAAATACTAATTTTACAGGACGCGGCTCAGGACACACCTCTCCTACTATTCTCCTCTCTCTCTCTCTCTAGAACACACAGACACACACCAAATTCACCAAACCAAACACCAATTGTGAAAATTCCGGCAACAAAACAAAGGATGCCGCTTTGCGACGTCGGAAAATACCAGTCTGGCGGCGATGCAGTTCTCAACAATGGTATAAAGATTTTCTACAGAACCTACGG...
Protein
Download Protein FASTA433 aa · TkA04G139190|TK1151|PROTEIN
LTLNLILLFFLKILILQDAAQDTPLLLFSSLSLSRTHRHTPNSPNQTPIVKIPATKQRMPLCDVGKYQSGGDAVLNNGIKIFYRTYGAGPVKVLMIIGLAATHDSWNPQIQGLIGTIKPNDDDHRSTNERGIEVCAIDNRGVGRSSIPTKRSEYTTRIMAKDAIAVMDHLGWKKAHVFGHSMGGMIASKLAAVFPDRIQSLALLNVTGGGYQCFPKLDRQTFSIAIRFLRAKTPAQRAAVDLDTHYTQEYLAEYVGAETR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G139190 |
|---|---|
| TK1151 ID | TkA04G139190 |
| OH-1004 ID | LXL04_035356 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 91.917 / OH-1004 82.744Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G139190 |
|---|---|
| Location | Chr04:36057603-36061174 (+) |
| Description | Similar to rutD: Putative aminoacrylate hydrolase RutD (Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006212 uracil catabolic process Biological Process GO:0009636 response to toxic substance Biological Process GO:0019740 nitrogen utilization Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0046839 phospholipid dephosphorylation Biological Process GO:0097176 epoxide metabolic process Biological Process GO:0005777 peroxisome Cellular Component GO:0016020 membrane Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0004301 epoxide hydrolase activity Molecular Function GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Molecular Function |
| KEGG gene cross-reference | ag:BAA14412 azc:AZC_2496 cak:Caul_3981 mch:Mchl_2054 ssc:414425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00561Abhydrolase_193-352 aaPF12697Abhydrolase_6113-359 aaPF12146Hydrolase_4128-207 aaPF03096Ndr146-209 aaPF12695Abhydrolase_5165-204 aaPF07819PGAP1174-197 aaPF00756Esterase175-202 aaPF00975Thioesterase176-193 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G139190 | PF00561 | Abhydrolase_1 | 93 | 352 | 2.9e-25 | 90.1 |
| TkA04G139190 | PF12697 | Abhydrolase_6 | 113 | 359 | 2e-11 | 45.7 |
| TkA04G139190 | PF12146 | Hydrolase_4 | 128 | 207 | 6.8e-12 | 45.9 |
| TkA04G139190 | PF03096 | Ndr | 146 | 209 | 0.0015 | 18.0 |
| TkA04G139190 | PF12695 | Abhydrolase_5 | 165 | 204 | 0.00079 | 20.0 |
| TkA04G139190 | PF07819 | PGAP1 | 174 | 197 | 0.047 | 14.1 |
| TkA04G139190 | PF00756 | Esterase | 175 | 202 | 0.2 | 12.1 |
| TkA04G139190 | PF00975 | Thioesterase | 176 | 193 | 0.013 | 16.4 |
| TkA04G139190 | PF07819 | PGAP1 | 285 | 322 | 0.047 | 14.1 |
| TkA04G139190 | PF12695 | Abhydrolase_5 | 307 | 346 | 0.00079 | 20.0 |
| TkA04G139190 | PF00975 | Thioesterase | 329 | 362 | 0.013 | 16.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.