TkA04G134390 | RubberDandelionOmics

Gene overview

TkA04G134390

Reference: TK1151 Chr: Chr04 Coordinates: 34967392-34972189 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2136 bp · TkA04G134390|TK1151|cDNA

ATAAAACACACATTCAAATGGCACCTCGATTGGAATGTTTCTGTATCTCCATTGAAATCATCTACATAAAAAATGCTATAAAAGTACGTATACGTGATGTTCTATGCTCGGACGGAGTAATTGTTGCCAGTAATGGGGCATTGCTGCAGCAAAGGCACCGTCGCAGCCTCAGCCGTGAAAGACGATGTTAACCATGGATCAACCGCTGCTGCCAGAAACCCCAATCAACACAATCCGCCGTCTCTGGGTGGCTCGATTGG...

CDS

Download CDS FASTA

1098 bp · TkA04G134390|TK1151|CDS

ATGAAATGTCAAAACAAGCTACTATTAACCTGTTTTTCAAAAGAAAACATTCAAGCTCTCAAAATCAAGAAAATGTACCAGAGATTGTTTTGGATGAAGACACATCTTTGCCTACTCATCATGTTCCTGTTACTGAGCTTAATTAAGATGTTTAGTCCAGTTTGTGAGGTTTTACTTAAAGTTATTGAGGAGGGAACCGGATCTATCAAAGGAGATGCAGATTCAGCATATGAGACTATTACTACATTTGAGTTTGTGTT...

Protein

Download Protein FASTA

365 aa · TkA04G134390|TK1151|PROTEIN

MKCQNKLLLTCFSKENIQALKIKKMYQRLFWMKTHLCLLIMFLLLSLIKMFSPVCEVLLKVIEEGTGSIKGDADSAYETITTFEFVFVLHLEKEILGITDLLCQALQRKSQDICNALRLVTSTKLLLQKMKNERWDDLLSCVTTFCQKRKIEIPDLSSSYSSRGARARKEHSNHTLEHHYRVDIFNEAINCQLMELDHRFNDNSMELLNLSATLDPNNANEHFQSGDVCNLAQKYYPEDFNDYEKEILKTQLLHYEVDVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G134390`
TK1151 ID	TkA04G134390
OH-1004 ID	LXL04_008339
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.100
Protein coverage (%)	TK1151 86.575 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G134390

Location Chr04:34967392-34972189 (+)

Description Similar to ZMYM1: Zinc finger MYM-type protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46700`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	No verified direct reference in this release
`At5g24430`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At3g49370`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At3g56760`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0366200`	Possesses kinase activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

hsa:79830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.573

Rank 1 · TkA04G134390 · TK1151

Cytoplasm0.441

Rank 2 · TkA04G134390 · TK1151

Mitochondrion0.048

Rank 3 · TkA04G134390 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA04G134390 · TK1151

Extracellular0.020

Rank 5 · TkA04G134390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15923DUF474596-204 aa

PF05699Dimer_Tnp_hAT270-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G134390	`PF15923`	DUF4745	96	204	0.15	12.7
TkA04G134390	`PF05699`	Dimer_Tnp_hAT	270	341	2.3e-11	44.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUZ2`	Arabidopsis thaliana	sp\|Q9ZUZ2\|CAMK3_ARATH CDPK-related kinase 3	68.000%	Swiss-Prot	High
`Q9FIM9`	Arabidopsis thaliana	sp\|Q9FIM9\|CAMK4_ARATH CDPK-related kinase 4	67.000%	Swiss-Prot	High
`Q9SG12`	Arabidopsis thaliana	sp\|Q9SG12\|CAMK6_ARATH CDPK-related kinase 6	65.100%	Swiss-Prot	High
`Q9LET1`	Arabidopsis thaliana	sp\|Q9LET1\|CAMK7_ARATH CDPK-related kinase 7	60.900%	Swiss-Prot	High
`Q10KY3`	Oryza sativa subsp. japonica	sp\|Q10KY3\|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1	61.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card