TkA04G132990 | RubberDandelionOmics

Gene overview

TkA04G132990

Reference: TK1151 Chr: Chr04 Coordinates: 34598868-34599221 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA04G132990|TK1151|cDNA

ATGTTATGGATGTGGGAGCATCAACTCCGTTCCTGTGGGCTTTTGAGGAGCGGGAAAAATTGTTGGAATTCTATGAAAGTCTCGGGAGCCAGGATGCATGCCAGTTTCATACGACCAGGTGGAGTGGCACAAGATCCGCCTCTTGGCTTATGTCGAGATATTGATTCCTCCACACAACAATTTGCTTCTCGTATCGACGAATTAGAAGAAATGTCAAGCGACAACCGTATCTGGAAACAACGATTAGTGGATATTGGCAC...

CDS

Download CDS FASTA

354 bp · TkA04G132990|TK1151|CDS

ATGTTATGGATGTGGGAGCATCAACTCCGTTCCTGTGGGCTTTTGAGGAGCGGGAAAAATTGTTGGAATTCTATGAAAGTCTCGGGAGCCAGGATGCATGCCAGTTTCATACGACCAGGTGGAGTGGCACAAGATCCGCCTCTTGGCTTATGTCGAGATATTGATTCCTCCACACAACAATTTGCTTCTCGTATCGACGAATTAGAAGAAATGTCAAGCGACAACCGTATCTGGAAACAACGATTAGTGGATATTGGCAC...

Protein

Download Protein FASTA

117 aa · TkA04G132990|TK1151|PROTEIN

MLWMWEHQLRSCGLLRSGKNCWNSMKVSGARMHASFIRPGGVAQDPPLGLCRDIDSSTQQFASRIDELEEMSSDNRIWKQRLVDIGTLTAQQAKDWDIKHFLLQQLLLIVVLCLKMT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G132990`
TK1151 ID	TkA04G132990
OH-1004 ID	LXL04_035405
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G132990

Location Chr04:34598868-34599221 (+)

Description Similar to NAD7: NADH dehydrogenase [ubiquinone] iron-sulfur protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`AtMg00510`	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035405 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

GO:0008137 NADH dehydrogenase (ubiquinone) activity Molecular Function

GO:0016651 oxidoreductase activity, acting on NAD(P)H Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0048038 quinone binding Molecular Function

GO:0051287 NAD binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.573

Rank 1 · TkA04G132990 · TK1151

Cytoplasm0.206

Rank 2 · TkA04G132990 · TK1151

Nucleus0.206

Rank 3 · TkA04G132990 · TK1151

Cell membrane0.058

Rank 4 · TkA04G132990 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA04G132990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00346Complex1_49kDa26-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G132990	`PF00346`	Complex1_49kDa	26	97	6.9e-20	72.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93306`	Arabidopsis thaliana	sp\|P93306\|NDUS2_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 2	82.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card